Symbol:
Pnck
Name:
pregnancy up-regulated nonubiquitous CaM kinase
RGD ID:
69249
Description:
Enables calcium/calmodulin-dependent protein kinase activity. Predicted to be involved in signal transduction. Predicted to be located in nucleus. Predicted to be active in cytoplasm. Orthologous to human PNCK (pregnancy up-regulated nonubiquitous CaM kinase); INTERACTS WITH 6-propyl-2-thiouracil; amitrole; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
calcium/calmodulin-dependent protein kinase 1 beta; calcium/calmodulin-dependent protein kinase 1, beta; calcium/calmodulin-dependent protein kinase type 1B; caM kinase I beta; caM kinase IB; caM-KI beta; Camk1b; caMKI-beta; LOC100360379; pregnancy up-regulated non-ubiquitously-expressed CaM kinase homolog; pregnancy upregulated non-ubiquitously expressed CaM kinase; Protein Kinase-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 156,520,751 - 156,524,828 (-) NCBI GRCr8 mRatBN7.2 X 151,369,406 - 151,373,508 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 151,369,410 - 151,373,446 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 153,510,581 - 153,514,481 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 157,073,812 - 157,077,712 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 154,745,644 - 154,749,544 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 157,150,071 - 157,154,558 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 157,150,655 - 157,154,555 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 152,900,009 - 152,904,076 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 45,741,127 - 45,741,920 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 159,628,959 - 159,632,860 (-) NCBI Celera 1 136,516,497 - 136,520,397 (+) NCBI Celera Cytogenetic Map X q37 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pnck Rat 1,2-dimethylhydrazine increases expression ISO Pnck (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PNCK mRNA CTD PMID:22206623 Pnck Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Pnck (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pnck Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Pnck (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pnck Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO PNCK (Homo sapiens) 6480464 PNCK mRNA affects the reaction [Tetrachlorodibenzodioxin results in increased activity of CYP1A1 protein] CTD PMID:21479225 Pnck Rat 4-hydroxyphenyl retinamide increases expression ISO Pnck (Mus musculus) 6480464 Fenretinide results in increased expression of PNCK mRNA CTD PMID:28973697 Pnck Rat 5-aza-2'-deoxycytidine affects expression ISO PNCK (Homo sapiens) 6480464 Decitabine affects the expression of PNCK mRNA CTD PMID:23300844 Pnck Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PNCK mRNA CTD PMID:24780913 Pnck Rat acrylamide decreases expression ISO PNCK (Homo sapiens) 6480464 Acrylamide results in decreased expression of PNCK mRNA CTD PMID:32763439 Pnck Rat actinomycin D multiple interactions ISO PNCK (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of PNCK mRNA CTD PMID:38460933 Pnck Rat aflatoxin B1 increases methylation ISO PNCK (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PNCK exon CTD PMID:30157460 Pnck Rat Aflatoxin B2 alpha increases methylation ISO PNCK (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PNCK exon CTD PMID:30157460 Pnck Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PNCK mRNA CTD PMID:38685447 Pnck Rat arsenite(3-) increases expression ISO Pnck (Mus musculus) 6480464 arsenite results in increased expression of PNCK mRNA CTD PMID:33053406 Pnck Rat benzo[a]pyrene multiple interactions ISO Pnck (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to PNCK promoter] CTD PMID:19654925 Pnck Rat benzo[a]pyrene decreases methylation ISO PNCK (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PNCK 3' UTR and Benzo(a)pyrene results in decreased methylation of PNCK promoter CTD PMID:27901495 Pnck Rat benzo[a]pyrene increases methylation ISO PNCK (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PNCK exon CTD PMID:27901495 Pnck Rat benzo[a]pyrene increases expression ISO Pnck (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PNCK mRNA CTD PMID:22228805 Pnck Rat bis(2-ethylhexyl) phthalate decreases expression ISO PNCK (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of PNCK mRNA CTD PMID:31163220 Pnck Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PNCK mRNA CTD PMID:25181051 and PMID:34947998 Pnck Rat bisphenol A affects expression ISO PNCK (Homo sapiens) 6480464 bisphenol A affects the expression of PNCK mRNA CTD PMID:30903817 Pnck Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PNCK gene CTD PMID:28505145 Pnck Rat cadmium dichloride decreases expression ISO PNCK (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PNCK mRNA CTD PMID:38382870 Pnck Rat carbon nanotube decreases expression ISO Pnck (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Pnck Rat choline multiple interactions ISO Pnck (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PNCK mRNA CTD PMID:20938992 Pnck Rat chrysene increases expression ISO Pnck (Mus musculus) 6480464 chrysene results in increased expression of PNCK mRNA CTD PMID:26377693 Pnck Rat cisplatin affects expression ISO PNCK (Homo sapiens) 6480464 Cisplatin affects the expression of PNCK mRNA CTD PMID:23300844 Pnck Rat dioxygen increases expression ISO PNCK (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of PNCK mRNA CTD PMID:26516004 Pnck Rat dorsomorphin multiple interactions ISO PNCK (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pnck Rat ethanol multiple interactions EXP 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of PNCK mRNA CTD PMID:17347304 Pnck Rat ethanol increases expression ISO Pnck (Mus musculus) 6480464 Ethanol results in increased expression of PNCK mRNA CTD PMID:30319688 Pnck Rat ethanol multiple interactions ISO Pnck (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of PNCK mRNA CTD PMID:30319688 Pnck Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of PNCK mRNA CTD PMID:34044035 Pnck Rat folic acid multiple interactions ISO Pnck (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PNCK mRNA CTD PMID:20938992 Pnck Rat L-methionine multiple interactions ISO Pnck (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PNCK mRNA CTD PMID:20938992 Pnck Rat lead(0) affects expression ISO PNCK (Homo sapiens) 6480464 Lead affects the expression of PNCK mRNA CTD PMID:28903495 Pnck Rat Licochalcone B increases expression ISO PNCK (Homo sapiens) 6480464 licochalcone B results in increased expression of PNCK mRNA CTD PMID:33647349 Pnck Rat lipopolysaccharide multiple interactions ISO PNCK (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of PNCK mRNA CTD PMID:35811015 Pnck Rat methylmercury chloride decreases expression ISO PNCK (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PNCK mRNA CTD PMID:28001369 Pnck Rat Nutlin-3 multiple interactions ISO PNCK (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of PNCK mRNA CTD PMID:38460933 Pnck Rat PCB138 multiple interactions ISO Pnck (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pnck Rat phenylmercury acetate decreases expression ISO PNCK (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of PNCK mRNA CTD PMID:26272509 Pnck Rat phenylmercury acetate multiple interactions ISO PNCK (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PNCK mRNA CTD PMID:27188386 Pnck Rat rotenone decreases expression ISO Pnck (Mus musculus) 6480464 Rotenone results in decreased expression of PNCK mRNA CTD PMID:23186747 Pnck Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PNCK (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of PNCK mRNA CTD PMID:35811015 Pnck Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO PNCK (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of PNCK mRNA CTD PMID:35811015 Pnck Rat SB 431542 multiple interactions ISO PNCK (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pnck Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of PNCK mRNA CTD PMID:19281266 Pnck Rat sulforaphane increases expression ISO PNCK (Homo sapiens) 6480464 sulforaphane results in increased expression of PNCK mRNA CTD PMID:31838189 Pnck Rat testosterone increases expression ISO PNCK (Homo sapiens) 6480464 Testosterone results in increased expression of PNCK mRNA CTD PMID:33359661 Pnck Rat titanium dioxide decreases methylation ISO Pnck (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PNCK gene CTD PMID:35295148 Pnck Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of PNCK gene CTD PMID:27618143 Pnck Rat trichostatin A decreases expression ISO PNCK (Homo sapiens) 6480464 trichostatin A results in decreased expression of PNCK mRNA CTD PMID:26272509 Pnck Rat trichostatin A multiple interactions ISO PNCK (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PNCK mRNA CTD PMID:27188386 Pnck Rat trimellitic anhydride decreases expression ISO Pnck (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of PNCK mRNA CTD PMID:19042947 Pnck Rat triptonide increases expression ISO Pnck (Mus musculus) 6480464 triptonide results in increased expression of PNCK mRNA CTD PMID:33045310 Pnck Rat valproic acid increases methylation ISO PNCK (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PNCK gene CTD PMID:29154799 Pnck Rat valproic acid decreases expression ISO PNCK (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PNCK mRNA CTD PMID:26272509 Pnck Rat valproic acid multiple interactions ISO PNCK (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PNCK mRNA CTD PMID:27188386
1,2-dimethylhydrazine (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) amitrole (EXP) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) carbon nanotube (ISO) choline (ISO) chrysene (ISO) cisplatin (ISO) dioxygen (ISO) dorsomorphin (ISO) ethanol (EXP,ISO) fipronil (EXP) folic acid (ISO) L-methionine (ISO) lead(0) (ISO) Licochalcone B (ISO) lipopolysaccharide (ISO) methylmercury chloride (ISO) Nutlin-3 (ISO) PCB138 (ISO) phenylmercury acetate (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) Soman (EXP) sulforaphane (ISO) testosterone (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) trimellitic anhydride (ISO) triptonide (ISO) valproic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
3.
Isoform-specific activation and structural diversity of calmodulin kinase I.
Naito Y, etal., J Biol Chem 1997 Dec 19;272(51):32704-8.
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
7.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
8.
Differential regulatory mechanism of Ca2+/calmodulin-dependent protein kinase kinase isoforms.
Tokumitsu H, etal., Biochemistry 2001 Nov 20;40(46):13925-32.
9.
Isolation and comparison of rat cDNAs encoding Ca2+/calmodulin-dependent protein kinase I isoforms.
Yokokura H, etal., Biochim Biophys Acta 1997 Mar 7;1338(1):8-12.
Pnck Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 156,520,751 - 156,524,828 (-) NCBI GRCr8 mRatBN7.2 X 151,369,406 - 151,373,508 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 151,369,410 - 151,373,446 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 153,510,581 - 153,514,481 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 157,073,812 - 157,077,712 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 154,745,644 - 154,749,544 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 157,150,071 - 157,154,558 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 157,150,655 - 157,154,555 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 152,900,009 - 152,904,076 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 45,741,127 - 45,741,920 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 159,628,959 - 159,632,860 (-) NCBI Celera 1 136,516,497 - 136,520,397 (+) NCBI Celera Cytogenetic Map X q37 NCBI
PNCK Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 153,669,733 - 153,687,771 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 153,669,733 - 153,689,010 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 152,935,188 - 152,953,226 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 152,588,417 - 152,592,974 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera X 153,168,872 - 153,173,500 (-) NCBI Celera Cytogenetic Map X q28 NCBI HuRef X 141,592,549 - 141,597,177 (-) NCBI HuRef CHM1_1 X 152,809,688 - 152,814,316 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 151,943,398 - 151,961,436 (-) NCBI T2T-CHM13v2.0
Pnck Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 72,699,598 - 72,703,723 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 72,699,600 - 72,703,723 (-) Ensembl GRCm39 Ensembl GRCm38 X 73,655,992 - 73,660,117 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 73,655,994 - 73,660,117 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 70,901,333 - 70,905,167 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 69,908,714 - 69,912,548 (-) NCBI MGSCv36 mm8 Celera X 64,909,809 - 64,913,643 (-) NCBI Celera Cytogenetic Map X A7.3 NCBI cM Map X 37.38 NCBI
Pnck Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955580 401,297 - 405,065 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955580 401,411 - 406,663 (-) NCBI ChiLan1.0 ChiLan1.0
PNCK Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 153,709,882 - 153,714,516 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 153,713,486 - 153,718,120 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 143,220,029 - 143,224,659 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 153,106,491 - 153,123,897 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 153,106,491 - 153,123,897 (-) Ensembl panpan1.1 panPan2
PNCK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 121,489,041 - 121,491,356 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 121,489,040 - 121,491,431 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 106,819,067 - 106,822,956 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 124,631,200 - 124,635,086 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 124,631,204 - 124,635,176 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 120,400,661 - 120,404,547 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 122,915,659 - 122,919,533 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 122,677,778 - 122,681,665 (-) NCBI UU_Cfam_GSD_1.0
Pnck
PNCK Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 124,425,872 - 124,429,261 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 124,425,867 - 124,430,000 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 141,989,364 - 141,993,498 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PNCK Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 128,099,736 - 128,104,348 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 128,099,682 - 128,103,121 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666065 65,961,824 - 65,966,436 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pnck
.
Predicted Target Of
Count of predictions: 343 Count of miRNA genes: 218 Interacting mature miRNAs: 252 Transcripts: ENSRNOT00000024227 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
634346 Insul4 Insulin level QTL 4 0 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) X 126975089 152453651 Rat 10059603 Bw174 Body weight QTL 174 3.4 0.025 body mass (VT:0001259) body weight (CMO:0000012) X 113937816 152453651 Rat
RH137751
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 151,369,452 - 151,369,587 (-) MAPPER mRatBN7.2 Rnor_6.0 X 157,154,378 - 157,154,512 NCBI Rnor6.0 Rnor_5.0 1 152,903,895 - 152,904,029 UniSTS Rnor5.0 RGSC_v3.4 X 159,555,568 - 159,555,702 UniSTS RGSC3.4 Celera 1 136,520,220 - 136,520,354 UniSTS RH 3.4 Map 1 1646.0 UniSTS Cytogenetic Map X q37 UniSTS
UniSTS:546957
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 151,369,441 - 151,370,707 (-) MAPPER mRatBN7.2 Rnor_6.0 X 157,153,258 - 157,154,523 NCBI Rnor6.0 Rnor_5.0 1 152,902,775 - 152,904,040 UniSTS Rnor5.0 Celera 1 136,519,100 - 136,520,365 UniSTS Cytogenetic Map X q37 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
9
40
109
83
79
57
12
57
6
178
71
93
36
55
22
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000090795 ⟹ ENSRNOP00000074179
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 151,369,410 - 151,373,310 (-) Ensembl Rnor_6.0 Ensembl X 157,150,655 - 157,154,555 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095467 ⟹ ENSRNOP00000094811
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 151,369,410 - 151,373,446 (-) Ensembl
RefSeq Acc Id:
NM_017275 ⟹ NP_058971
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 156,520,753 - 156,524,653 (-) NCBI mRatBN7.2 X 151,369,410 - 151,373,310 (-) NCBI Rnor_6.0 X 157,150,655 - 157,154,555 (+) NCBI Rnor_5.0 1 152,900,009 - 152,904,076 (+) NCBI RGSC_v3.4 X 45,741,127 - 45,741,920 (+) RGD Celera 1 136,516,497 - 136,520,397 (+) NCBI
Sequence:
AAGGCATCTTACGTCCGCAGCCCACCACCCTCACACACACCTGTGACGCCCGGCGCGCCCCCCTGCCCGCACGCGCACAGCCCACGCAGCTCTGGACACAGGCGGCTGAGGTTGCGGAGTCCCCCCAC
hide sequence
RefSeq Acc Id:
XM_006229572 ⟹ XP_006229634
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 156,520,751 - 156,524,760 (-) NCBI mRatBN7.2 X 151,369,406 - 151,373,373 (-) NCBI Rnor_6.0 X 157,150,604 - 157,154,558 (+) NCBI Rnor_5.0 1 152,900,009 - 152,904,076 (+) NCBI
Sequence:
ACTGGGGGCAAACAGGCGAGCGGAACCGGCGGGCCGGGGCGTACAGGGACCAAGGCATCTTAGCTCCGCAGCCCACCACCCTCACACACACCTGTGACGCCCGGCGCGCCCCCCTGCCCGCACGCGCA
hide sequence
RefSeq Acc Id:
XM_006229573 ⟹ XP_006229635
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 156,520,751 - 156,524,828 (-) NCBI mRatBN7.2 X 151,369,406 - 151,373,508 (-) NCBI Rnor_6.0 X 157,150,511 - 157,154,558 (+) NCBI Rnor_5.0 1 152,900,009 - 152,904,076 (+) NCBI
Sequence:
GCTCGGCGACACAACAGCTACTGCGCTAGGAGACATTGCGGCGGCGGTGGCGGCGTTGGCAGCAGCTGCAGACATGCTGCTGCTCAAGAAACAGACGGAGGACATCAGCAGTGTCTATGAGATCCGGG
hide sequence
RefSeq Acc Id:
XM_006229575 ⟹ XP_006229637
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 156,520,751 - 156,524,713 (-) NCBI mRatBN7.2 X 151,369,406 - 151,373,373 (-) NCBI Rnor_6.0 X 157,150,604 - 157,154,558 (+) NCBI Rnor_5.0 1 152,900,009 - 152,904,076 (+) NCBI
Sequence:
ACTGGGGGCAAACAGGCGAGCGGAACCGGCGGGCCGGGGCGTACAGGGACCAAGGCATCTTAGCTCCGCAGCCCACCACCCTCACACACACCTGTGACGCCCGGCGCGCCCCCCTGCCCGCACGCGCA
hide sequence
RefSeq Acc Id:
XM_008773628 ⟹ XP_008771850
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 156,520,751 - 156,524,298 (-) NCBI mRatBN7.2 X 151,369,406 - 151,372,964 (-) NCBI Rnor_6.0 X 157,150,944 - 157,154,558 (+) NCBI
Sequence:
CAAGGGCCCTATGGGTGGAGGTGGGTCTCATGAACCAGGATCAGAGTGTATGGAGCCTTCTGGA
hide sequence
RefSeq Acc Id:
XM_063279872 ⟹ XP_063135942
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 156,520,751 - 156,524,767 (-) NCBI
RefSeq Acc Id:
XM_063279873 ⟹ XP_063135943
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 156,520,751 - 156,524,717 (-) NCBI
RefSeq Acc Id:
NP_058971 ⟸ NM_017275
- UniProtKB:
O08767 (UniProtKB/Swiss-Prot), O70150 (UniProtKB/Swiss-Prot), A6KRX3 (UniProtKB/TrEMBL), A6KRX2 (UniProtKB/TrEMBL)
- Sequence:
MLLLKKQTEDISSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLH
hide sequence
RefSeq Acc Id:
XP_006229635 ⟸ XM_006229573
- Peptide Label:
isoform X2
- UniProtKB:
O08767 (UniProtKB/Swiss-Prot), O70150 (UniProtKB/Swiss-Prot), A6KRX3 (UniProtKB/TrEMBL), A6KRX2 (UniProtKB/TrEMBL)
- Sequence:
MLLLKKQTEDISSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLH
hide sequence
RefSeq Acc Id:
XP_006229634 ⟸ XM_006229572
- Peptide Label:
isoform X1
- UniProtKB:
A6KRX1 (UniProtKB/TrEMBL), A6KRX2 (UniProtKB/TrEMBL)
- Sequence:
MEDMLLLKKQTEDISSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVS
hide sequence
RefSeq Acc Id:
XP_006229637 ⟸ XM_006229575
- Peptide Label:
isoform X2
- UniProtKB:
O08767 (UniProtKB/Swiss-Prot), O70150 (UniProtKB/Swiss-Prot), A6KRX3 (UniProtKB/TrEMBL), A6KRX2 (UniProtKB/TrEMBL)
- Sequence:
MLLLKKQTEDISSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLH
hide sequence
RefSeq Acc Id:
XP_008771850 ⟸ XM_008773628
- Peptide Label:
isoform X2
- UniProtKB:
O08767 (UniProtKB/Swiss-Prot), O70150 (UniProtKB/Swiss-Prot), A6KRX3 (UniProtKB/TrEMBL), A6KRX2 (UniProtKB/TrEMBL)
- Sequence:
MLLLKKQTEDISSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLH
hide sequence
Ensembl Acc Id:
ENSRNOP00000074179 ⟸ ENSRNOT00000090795
Ensembl Acc Id:
ENSRNOP00000094811 ⟸ ENSRNOT00000095467
RefSeq Acc Id:
XP_063135942 ⟸ XM_063279872
- Peptide Label:
isoform X2
- UniProtKB:
O70150 (UniProtKB/Swiss-Prot), O08767 (UniProtKB/Swiss-Prot), A6KRX3 (UniProtKB/TrEMBL), A6KRX2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063135943 ⟸ XM_063279873
- Peptide Label:
isoform X3
- UniProtKB:
A6KRX2 (UniProtKB/TrEMBL)
BioCyc Gene G2FUF-669 BioCyc
Ensembl Genes ENSRNOG00000058317 Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript ENSRNOT00000090795.2 UniProtKB/Swiss-Prot
ENSRNOT00000095467.1 UniProtKB/Swiss-Prot
Gene3D-CATH Phosphorylase Kinase, domain 1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Transferase(Phosphotransferase) domain 1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro CaMKI_beta_STKc UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Kinase-like_dom_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Prot_kinase_dom UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Protein_kinase_ATP_BS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ser/Thr_kinase_AS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:29660 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene 29660 ENTREZGENE
PANTHER SERINE/THREONINE-PROTEIN KINASE UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam Pkinase UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Pnck PhenoGen
PROSITE PROTEIN_KINASE_ATP UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROTEIN_KINASE_DOM UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROTEIN_KINASE_ST UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000058317 RatGTEx
SMART S_TKc UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP Protein kinase-like (PK-like) UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
TIGR TC231859
UniProt A6KRX1 ENTREZGENE, UniProtKB/TrEMBL
A6KRX2 ENTREZGENE, UniProtKB/TrEMBL
A6KRX3 ENTREZGENE, UniProtKB/TrEMBL
KCC1B_RAT UniProtKB/Swiss-Prot
O08767 ENTREZGENE
O70150 ENTREZGENE
UniProt Secondary O08767 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-11-22
Pnck
pregnancy up-regulated nonubiquitous CaM kinase
Pnck
pregnancy upregulated non-ubiquitously expressed CaM kinase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-04-17
Pnck
pregnancy upregulated non-ubiquitously expressed CaM kinase
LOC100360379
Protein Kinase-like
Data merged from RGD:2322274
737654 PROVISIONAL
2010-05-06
LOC100360379
Protein Kinase-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2003-04-09
Pnck
pregnancy upregulated non-ubiquitously expressed CaM kinase
Camk1b
calcium/calmodulin-dependent protein kinase 1, beta
Symbol and Name updated
629477 APPROVED
2002-06-10
Camk1b
calcium/calmodulin-dependent protein kinase 1, beta
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
alternatively spliced form CaM kiinase Ibeta2 is exprssed in cerebrum and cerebellum; alternatively spliced form CaM kinase IbetaI is expressed in liver, heart, lung, and kidney, spleen, and testis
68883
