Symbol:
Sytl5
Name:
synaptotagmin-like 5
RGD ID:
631342
Description:
Predicted to enable neurexin family protein binding activity. Predicted to be involved in exocytosis. Predicted to be located in membrane. Predicted to be active in exocytic vesicle and plasma membrane. Orthologous to human SYTL5 (synaptotagmin like 5); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
synaptotagmin 15; synaptotagmin-like protein 5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SYTL5 (synaptotagmin like 5) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Sytl5 (synaptotagmin-like 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sytl5 (synaptotagmin like 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SYTL5 (synaptotagmin like 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SYTL5 (synaptotagmin like 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sytl5 (synaptotagmin like 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SYTL5 (synaptotagmin like 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SYTL5 (synaptotagmin like 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sytl5 (synaptotagmin like 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SYTL5 (synaptotagmin like 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Sytl5 (synaptotagmin-like 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sytl5 (synaptotagmin-like 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
btsz
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
sytl5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 15,461,215 - 15,702,660 (-) NCBI GRCr8 mRatBN7.2 X 12,775,529 - 13,030,134 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 12,788,698 - 13,030,175 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 12,980,058 - 13,068,810 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 16,476,998 - 16,565,752 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 12,733,565 - 12,822,327 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 13,857,669 - 14,109,592 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 14,019,961 - 14,109,568 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 14,642,886 - 14,891,896 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 24,945,436 - 25,034,025 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 25,059,892 - 25,087,494 (-) NCBI Celera X 13,398,414 - 13,486,944 (-) NCBI Celera Cytogenetic Map X q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sytl5 Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:1332020 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Sytl5 Rat 17beta-estradiol increases expression ISO RGD:736279 6480464 Estradiol results in increased expression of SYTL5 mRNA CTD PMID:19167446|PMID:21185374|PMID:24758408|PMID:31614463 Sytl5 Rat 17beta-estradiol decreases expression ISO RGD:1332020 6480464 Estradiol results in decreased expression of SYTL5 mRNA CTD PMID:39298647 Sytl5 Rat 17beta-estradiol multiple interactions ISO RGD:736279 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of SYTL5 mRNA; [Estradiol co-treated more ... CTD PMID:20404318|PMID:20660070|PMID:24758408 Sytl5 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1332020 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Sytl5 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:1332020 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Sytl5 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1332020 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to SYTL5 promoter] CTD PMID:19654925 Sytl5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SYTL5 mRNA CTD PMID:32109520 Sytl5 Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:1332020 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Sytl5 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of SYTL5 mRNA CTD PMID:32119087 Sytl5 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1332020 6480464 bisphenol S results in decreased expression of SYTL5 mRNA CTD PMID:39298647 Sytl5 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SYTL5 mRNA CTD PMID:24780913 Sytl5 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of SYTL5 mRNA CTD PMID:31881176 Sytl5 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of SYTL5 mRNA CTD PMID:28959563 Sytl5 Rat aflatoxin B1 decreases methylation ISO RGD:736279 6480464 Aflatoxin B1 results in decreased methylation of SYTL5 gene CTD PMID:27153756 Sytl5 Rat all-trans-retinoic acid increases expression ISO RGD:736279 6480464 Tretinoin results in increased expression of SYTL5 mRNA CTD PMID:21934132|PMID:23830798 Sytl5 Rat all-trans-retinoic acid multiple interactions ISO RGD:1332020 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of SYTL5 mRNA CTD PMID:36189433 Sytl5 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SYTL5 mRNA CTD PMID:16483693 Sytl5 Rat benzo[a]pyrene increases methylation ISO RGD:736279 6480464 Benzo(a)pyrene results in increased methylation of SYTL5 3' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Sytl5 Rat benzo[a]pyrene decreases expression ISO RGD:736279 6480464 Benzo(a)pyrene results in decreased expression of SYTL5 mRNA CTD PMID:32234424 Sytl5 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:736279 6480464 Diethylhexyl Phthalate results in increased expression of SYTL5 mRNA CTD PMID:31163220 Sytl5 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SYTL5 mRNA CTD PMID:25181051 Sytl5 Rat buta-1,3-diene increases expression ISO RGD:1332020 6480464 1,3-butadiene results in increased expression of SYTL5 mRNA CTD PMID:29038090 Sytl5 Rat cadmium atom increases expression ISO RGD:736279 6480464 Cadmium results in increased expression of SYTL5 mRNA CTD PMID:24376830 Sytl5 Rat carbamazepine affects expression ISO RGD:736279 6480464 Carbamazepine affects the expression of SYTL5 mRNA CTD PMID:25979313 Sytl5 Rat carbon nanotube decreases expression ISO RGD:1332020 6480464 Nanotubes, Carbon analog results in decreased expression of SYTL5 mRNA CTD PMID:25620056 Sytl5 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of SYTL5 mRNA CTD PMID:18500788 Sytl5 Rat CGP 52608 multiple interactions ISO RGD:736279 6480464 CGP 52608 promotes the reaction [RORA protein binds to SYTL5 gene] CTD PMID:28238834 Sytl5 Rat coumestrol multiple interactions ISO RGD:736279 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of SYTL5 mRNA; [Coumestrol co-treated with resveratrol] more ... CTD PMID:19167446 Sytl5 Rat coumestrol increases expression ISO RGD:736279 6480464 Coumestrol results in increased expression of SYTL5 mRNA CTD PMID:19167446 Sytl5 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of SYTL5 mRNA CTD PMID:27523638 Sytl5 Rat cyclosporin A decreases expression ISO RGD:736279 6480464 Cyclosporine results in decreased expression of SYTL5 mRNA CTD PMID:27989131 Sytl5 Rat dorsomorphin multiple interactions ISO RGD:736279 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Sytl5 Rat Enterolactone multiple interactions ISO RGD:736279 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of SYTL5 mRNA CTD PMID:19167446 Sytl5 Rat ethanol increases expression ISO RGD:1332020 6480464 Ethanol results in increased expression of SYTL5 mRNA CTD PMID:30319688 Sytl5 Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of SYTL5 gene CTD PMID:35440735 Sytl5 Rat ivermectin decreases expression ISO RGD:736279 6480464 Ivermectin results in decreased expression of SYTL5 protein CTD PMID:32959892 Sytl5 Rat Licochalcone B decreases expression ISO RGD:736279 6480464 licochalcone B results in decreased expression of SYTL5 mRNA CTD PMID:33647349 Sytl5 Rat lipopolysaccharide multiple interactions ISO RGD:736279 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of SYTL5 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Sytl5 Rat methotrexate increases mutagenesis ISO RGD:1332020 6480464 Methotrexate results in increased mutagenesis of SYTL5 gene CTD PMID:22806879 Sytl5 Rat methylmercury chloride decreases expression ISO RGD:736279 6480464 methylmercuric chloride results in decreased expression of SYTL5 mRNA CTD PMID:23179753|PMID:28001369 Sytl5 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:1332020 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of SYTL5 mRNA CTD PMID:36189433 Sytl5 Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of SYTL5 mRNA CTD PMID:21515302 Sytl5 Rat O-methyleugenol decreases expression ISO RGD:736279 6480464 methyleugenol results in decreased expression of SYTL5 mRNA CTD PMID:32234424 Sytl5 Rat okadaic acid decreases expression ISO RGD:736279 6480464 Okadaic Acid results in decreased expression of SYTL5 mRNA CTD PMID:38832940 Sytl5 Rat ozone multiple interactions ISO RGD:1332020 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of SYTL5 more ... CTD PMID:34911549 Sytl5 Rat paracetamol increases expression ISO RGD:1332020 6480464 Acetaminophen results in increased expression of SYTL5 mRNA CTD PMID:29246445 Sytl5 Rat paracetamol multiple interactions ISO RGD:1332020 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of SYTL5 mRNA] CTD PMID:29246445 Sytl5 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of SYTL5 mRNA CTD PMID:32680482 Sytl5 Rat PCB138 multiple interactions ISO RGD:1332020 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Sytl5 Rat perfluorooctanoic acid multiple interactions ISO RGD:736279 6480464 [Plasticizers co-treated with Cosmetics co-treated with Flame Retardants co-treated with perfluorooctanoic acid co-treated with Phytoestrogens] more ... CTD PMID:33325755 Sytl5 Rat phenylmercury acetate increases expression ISO RGD:736279 6480464 Phenylmercuric Acetate results in increased expression of SYTL5 mRNA CTD PMID:26272509 Sytl5 Rat phenylmercury acetate multiple interactions ISO RGD:736279 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Sytl5 Rat phytoestrogen multiple interactions ISO RGD:736279 6480464 [Plasticizers co-treated with Cosmetics co-treated with Flame Retardants co-treated with perfluorooctanoic acid co-treated with Phytoestrogens] more ... CTD PMID:33325755 Sytl5 Rat progesterone multiple interactions ISO RGD:736279 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of SYTL5 mRNA CTD PMID:20660070 Sytl5 Rat resveratrol multiple interactions ISO RGD:736279 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of SYTL5 mRNA CTD PMID:19167446 Sytl5 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO RGD:736279 6480464 S-(1,2-dichlorovinyl)cysteine results in increased expression of SYTL5 mRNA CTD PMID:35811015 Sytl5 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:736279 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of SYTL5 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Sytl5 Rat SB 431542 multiple interactions ISO RGD:736279 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Sytl5 Rat silver atom decreases expression ISO RGD:1332020 6480464 Silver results in decreased expression of SYTL5 mRNA CTD PMID:27131904 Sytl5 Rat silver(0) decreases expression ISO RGD:1332020 6480464 Silver results in decreased expression of SYTL5 mRNA CTD PMID:27131904 Sytl5 Rat sodium arsenite decreases expression ISO RGD:736279 6480464 sodium arsenite results in decreased expression of SYTL5 mRNA CTD PMID:34032870 Sytl5 Rat sodium arsenite decreases expression ISO RGD:1332020 6480464 sodium arsenite results in decreased expression of SYTL5 mRNA CTD PMID:37682722 Sytl5 Rat sodium fluoride decreases expression ISO RGD:1332020 6480464 Sodium Fluoride results in decreased expression of SYTL5 mRNA CTD PMID:27862939 Sytl5 Rat sunitinib decreases expression ISO RGD:736279 6480464 Sunitinib results in decreased expression of SYTL5 mRNA CTD PMID:31533062 Sytl5 Rat tetrachloromethane increases expression ISO RGD:1332020 6480464 Carbon Tetrachloride results in increased expression of SYTL5 mRNA CTD PMID:29987408 Sytl5 Rat titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of SYTL5 mRNA CTD PMID:30012374 Sytl5 Rat trichostatin A decreases expression ISO RGD:736279 6480464 trichostatin A results in decreased expression of SYTL5 mRNA CTD PMID:24935251 Sytl5 Rat triptonide increases expression ISO RGD:1332020 6480464 triptonide results in increased expression of SYTL5 mRNA CTD PMID:33045310 Sytl5 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of SYTL5 mRNA CTD PMID:21515302 Sytl5 Rat valproic acid decreases expression ISO RGD:736279 6480464 Valproic Acid results in decreased expression of SYTL5 mRNA CTD PMID:23179753 Sytl5 Rat valproic acid increases expression ISO RGD:736279 6480464 Valproic Acid results in increased expression of SYTL5 mRNA CTD PMID:24383497|PMID:28001369 Sytl5 Rat valproic acid affects expression ISO RGD:736279 6480464 Valproic Acid affects the expression of SYTL5 mRNA CTD PMID:25979313 Sytl5 Rat vorinostat multiple interactions ISO RGD:736279 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Sytl5 Rat vorinostat increases expression ISO RGD:736279 6480464 vorinostat results in increased expression of SYTL5 mRNA CTD PMID:26272509
1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) buta-1,3-diene (ISO) cadmium atom (ISO) carbamazepine (ISO) carbon nanotube (ISO) cefaloridine (EXP) CGP 52608 (ISO) coumestrol (ISO) Cuprizon (EXP) cyclosporin A (ISO) dorsomorphin (ISO) Enterolactone (ISO) ethanol (ISO) glyphosate (EXP) ivermectin (ISO) Licochalcone B (ISO) lipopolysaccharide (ISO) methotrexate (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) Muraglitazar (EXP) O-methyleugenol (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (ISO) paraquat (EXP) PCB138 (ISO) perfluorooctanoic acid (ISO) phenylmercury acetate (ISO) phytoestrogen (ISO) progesterone (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sunitinib (ISO) tetrachloromethane (ISO) titanium dioxide (EXP) trichostatin A (ISO) triptonide (ISO) troglitazone (EXP) valproic acid (ISO) vorinostat (ISO)
Sytl5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 15,461,215 - 15,702,660 (-) NCBI GRCr8 mRatBN7.2 X 12,775,529 - 13,030,134 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 12,788,698 - 13,030,175 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 12,980,058 - 13,068,810 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 16,476,998 - 16,565,752 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 12,733,565 - 12,822,327 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 13,857,669 - 14,109,592 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 14,019,961 - 14,109,568 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 14,642,886 - 14,891,896 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 24,945,436 - 25,034,025 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 25,059,892 - 25,087,494 (-) NCBI Celera X 13,398,414 - 13,486,944 (-) NCBI Celera Cytogenetic Map X q12 NCBI
SYTL5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 37,888,915 - 38,128,820 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 38,006,553 - 38,128,819 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 37,865,806 - 37,988,073 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 37,778,087 - 37,870,927 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 37,649,359 - 37,742,200 NCBI Celera X 42,003,495 - 42,125,714 (+) NCBI Celera Cytogenetic Map X p11.4 NCBI HuRef X 35,611,538 - 35,733,083 (+) NCBI HuRef CHM1_1 X 37,896,717 - 38,019,127 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 37,292,501 - 37,532,417 (+) NCBI T2T-CHM13v2.0
Sytl5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 9,613,851 - 9,871,268 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 9,751,861 - 9,860,782 (+) Ensembl GRCm39 Ensembl GRCm38 X 9,747,622 - 9,998,864 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 9,885,622 - 9,994,543 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 9,462,748 - 9,571,669 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 9,042,581 - 9,151,502 (+) NCBI MGSCv36 mm8 Celera X 7,598,989 - 7,706,928 (+) NCBI Celera Cytogenetic Map X A1.1 NCBI cM Map X 4.62 NCBI
Sytl5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955601 76,647 - 210,208 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955601 76,647 - 210,198 (+) NCBI ChiLan1.0 ChiLan1.0
SYTL5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 39,553,788 - 39,776,560 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 39,557,169 - 39,779,938 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 30,355,289 - 30,578,052 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 38,164,569 - 38,286,366 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 38,164,308 - 38,288,628 (+) Ensembl panpan1.1 panPan2
SYTL5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 32,652,389 - 32,886,793 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 32,651,968 - 32,879,525 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 20,001,349 - 20,232,716 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 32,699,069 - 32,931,470 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 32,698,624 - 32,930,845 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 32,780,480 - 33,012,485 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 32,744,381 - 32,984,277 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 32,904,116 - 33,023,381 (+) NCBI UU_Cfam_GSD_1.0
Sytl5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 24,909,573 - 25,149,712 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936502 4,750,233 - 4,987,887 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936502 4,873,750 - 4,987,742 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SYTL5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 33,798,291 - 34,036,242 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 33,798,296 - 34,066,127 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 37,773,056 - 37,854,459 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SYTL5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666133 335,476 - 392,265 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sytl5
.
Predicted Target Of
Count of predictions: 45 Count of miRNA genes: 40 Interacting mature miRNAs: 45 Transcripts: ENSRNOT00000004785 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
70165 Bp64 Blood pressure QTL 64 5.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) X 1448129 31706553 Rat 1298071 Edpm12 Estrogen-dependent pituitary mass QTL 12 3.2 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) X 2927898 47927898 Rat 731181 Uae27 Urinary albumin excretion QTL 27 2.7 0.0059 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) X 1 43491017 Rat 10755455 Coatc13 Coat color QTL 13 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 4406000 49406000 Rat 631666 Iddm5 Insulin dependent diabetes mellitus QTL 5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) X 4494549 49494549 Rat 634325 Bw13 Body weight QTL 13 0 body mass (VT:0001259) body weight (CMO:0000012) X 1447972 20991088 Rat 631204 Gluco15 Glucose level QTL 15 0.001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) X 1623715 22646544 Rat
ha2932
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 88,206,089 - 88,206,554 (+) MAPPER mRatBN7.2 Rnor_6.0 X 94,919,050 - 94,919,514 NCBI Rnor6.0 Rnor_5.0 X 94,807,178 - 94,807,642 UniSTS Rnor5.0 Celera X 13,417,319 - 13,418,573 UniSTS Celera X 89,371,262 - 89,371,726 UniSTS Cytogenetic Map X q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
8
36
113
79
78
47
23
47
6
188
79
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004785 ⟹ ENSRNOP00000004785
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 12,788,698 - 12,957,923 (-) Ensembl Rnor_6.0 Ensembl X 14,019,961 - 14,109,568 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113935 ⟹ ENSRNOP00000089213
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 12,788,698 - 13,030,175 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114439 ⟹ ENSRNOP00000094316
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 12,788,698 - 13,030,175 (-) Ensembl
RefSeq Acc Id:
NM_178333 ⟹ NP_848016
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 15,461,473 - 15,550,272 (-) NCBI mRatBN7.2 X 12,788,959 - 12,877,756 (-) NCBI Rnor_6.0 X 14,020,157 - 14,108,951 (+) NCBI Rnor_5.0 X 14,642,886 - 14,891,896 (+) NCBI RGSC_v3.4 X 24,945,436 - 25,034,025 (-) RGD Celera X 13,398,414 - 13,486,944 (-) RGD
Sequence:
ATGTCTAAGAACTCGGAGTTCATCAATCTGTCATTTTTATTGGATCATGAGAAGGAAATGATCCTCGGAGTCCTAAAGAGAGATGAATATTTGAAAAAGGTGGAAGACAAGAGGATAAGGAAGCTGAA
hide sequence
RefSeq Acc Id:
XM_008773070 ⟹ XP_008771292
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 15,461,215 - 15,630,091 (-) NCBI mRatBN7.2 X 12,775,529 - 12,957,585 (-) NCBI Rnor_6.0 X 13,857,669 - 14,109,592 (+) NCBI
Sequence:
TGTGAGGGGTTGGTTGGTCCTGAAGGCCTCAGCAATGAGAGTCCAGAAGCCATGTGGAAGGTATGTAGGGTTCGCATAGAGAGTCCGAGAGATGAGGGAGCCCGGCGACAGGCTCAGCGGGCAGGCCG
hide sequence
RefSeq Acc Id:
XM_017601991 ⟹ XP_017457480
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 15,461,215 - 15,630,091 (-) NCBI mRatBN7.2 X 12,775,529 - 12,957,585 (-) NCBI Rnor_6.0 X 13,938,796 - 14,109,592 (+) NCBI
Sequence:
ACAAGCCAGTCTGGTCTAGGCAATTCCTTAATCAAGGCTTTTCCTTCATAAAGACTCTAGGATATGACAAACTGATAATTAAAGATACCTAGGACAGGTGTCTTCCTTGATCAGTCTTAACCTTTCTT
hide sequence
RefSeq Acc Id:
XM_039099626 ⟹ XP_038955554
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 15,461,215 - 15,630,091 (-) NCBI mRatBN7.2 X 12,775,529 - 12,957,585 (-) NCBI
RefSeq Acc Id:
XM_039099627 ⟹ XP_038955555
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 15,461,215 - 15,630,091 (-) NCBI mRatBN7.2 X 12,775,529 - 12,957,585 (-) NCBI
RefSeq Acc Id:
XM_063279914 ⟹ XP_063135984
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 15,461,215 - 15,702,659 (-) NCBI
RefSeq Acc Id:
XM_063279915 ⟹ XP_063135985
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 15,461,215 - 15,630,091 (-) NCBI
RefSeq Acc Id:
XM_063279916 ⟹ XP_063135986
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 15,461,215 - 15,702,660 (-) NCBI
RefSeq Acc Id:
NP_848016 ⟸ NM_178333
- UniProtKB:
Q812E4 (UniProtKB/Swiss-Prot), A0A8I6AHG7 (UniProtKB/TrEMBL), A6K022 (UniProtKB/TrEMBL)
- Sequence:
MSKNSEFINLSFLLDHEKEMILGVLKRDEYLKKVEDKRIRKLKNELLEAKRRSGKTHQEANRVCVHCQKSLGLIFDRGAPCQACSLRVCSECRVTGLDGSWKCTVCAKVAQLRIISGEWFLEEKAKRF
hide sequence
RefSeq Acc Id:
XP_008771292 ⟸ XM_008773070
- Peptide Label:
isoform X2
- UniProtKB:
Q812E4 (UniProtKB/Swiss-Prot)
- Sequence:
MSKNSEFINLSFLLDHEKEMILGVLKRDEYLKKVEDKRIRKLKNELLEAKRRSGKTHQEANRVCVHCQKSLGLIFDRGDPCQACSLRVCSECRVTGLDGSWKCTVCAKVAQLRIISGEWFLEEKAKRF
hide sequence
RefSeq Acc Id:
XP_017457480 ⟸ XM_017601991
- Peptide Label:
isoform X1
- UniProtKB:
Q812E4 (UniProtKB/Swiss-Prot), A0A8I6AHG7 (UniProtKB/TrEMBL), A6K022 (UniProtKB/TrEMBL)
- Sequence:
MSKNSEFINLSFLLDHEKEMILGVLKRDEYLKKVEDKRIRKLKNELLEAKRRSGKTHQEANRVCVHCQKSLGLIFDRGDPCQACSLRVCSECRVTGLDGSWKCTVCAKVAQLRIISGEWFLEEKAKRF
hide sequence
Ensembl Acc Id:
ENSRNOP00000004785 ⟸ ENSRNOT00000004785
RefSeq Acc Id:
XP_038955555 ⟸ XM_039099627
- Peptide Label:
isoform X1
- UniProtKB:
Q812E4 (UniProtKB/Swiss-Prot), A0A8I6AHG7 (UniProtKB/TrEMBL), A6K022 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955554 ⟸ XM_039099626
- Peptide Label:
isoform X1
- UniProtKB:
Q812E4 (UniProtKB/Swiss-Prot), A0A8I6AHG7 (UniProtKB/TrEMBL), A6K022 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000089213 ⟸ ENSRNOT00000113935
Ensembl Acc Id:
ENSRNOP00000094316 ⟸ ENSRNOT00000114439
RefSeq Acc Id:
XP_063135986 ⟸ XM_063279916
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063135984 ⟸ XM_063279914
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063135985 ⟸ XM_063279915
- Peptide Label:
isoform X3
- UniProtKB:
Q812E4 (UniProtKB/Swiss-Prot), G3V6F7 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Sytl5
synaptotagmin-like 5
synaptotagmin 15
Name updated
1299863 APPROVED
2004-02-11
Slc1a7
synaptotagmin 15
Sytl5
synaptotagmin-like 5
Name updated to reflect Human and Mouse nomenclature
625702 APPROVED
