Symbol:
Gcm1
Name:
glial cells missing transcription factor 1
RGD ID:
61852
Description:
Predicted to enable several functions, including DNA-binding transcription activator activity, RNA polymerase II-specific; histone deacetylase binding activity; and zinc ion binding activity. Predicted to be involved in several processes, including cell differentiation involved in embryonic placenta development; regulation of cell differentiation involved in embryonic placenta development; and transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including astrocyte fate commitment; branching involved in labyrinthine layer morphogenesis; and positive regulation of syncytium formation by plasma membrane fusion. Predicted to be part of transcription regulator complex. Predicted to be active in nucleus. Orthologous to human GCM1 (glial cells missing transcription factor 1); INTERACTS WITH (S)-nicotine; 2,2',4,4'-Tetrabromodiphenyl ether; 3,7-dihydropurine-6-thione.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
chorion-specific transcription factor GCMa; GCM motif protein 1; Gcma; glial cells missing homolog 1; glial cells missing homolog 1 (Drosophila)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GCM1 (glial cells missing transcription factor 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Gcm1 (glial cells missing homolog 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gcm1 (glial cells missing transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GCM1 (glial cells missing transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GCM1 (glial cells missing transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gcm1 (glial cells missing transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GCM1 (glial cells missing transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GCM1 (glial cells missing transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gcm1 (glial cells missing transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Gcm1 (glial cells missing homolog 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GCM1 (glial cells missing transcription factor 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
gcm2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
gcm1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 87,805,993 - 87,819,229 (+) NCBI GRCr8 mRatBN7.2 8 78,925,687 - 78,938,924 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 78,925,687 - 78,938,924 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 84,412,841 - 84,426,055 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 82,689,502 - 82,702,716 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 80,512,207 - 80,525,423 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 85,355,766 - 85,369,002 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 85,355,766 - 85,369,002 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 84,920,654 - 84,933,890 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 83,018,975 - 83,032,211 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 83,038,028 - 83,051,265 (+) NCBI Celera 8 78,670,476 - 78,683,712 (+) NCBI Celera Cytogenetic Map 8 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gcm1 Rat (25R)-cholest-5-ene-3beta,26-diol decreases expression ISO Gcm1 (Mus musculus) 6480464 27-hydroxycholesterol results in decreased expression of GCM1 protein CTD PMID:38180513 Gcm1 Rat (25R)-cholest-5-ene-3beta,26-diol decreases expression ISO GCM1 (Homo sapiens) 6480464 27-hydroxycholesterol results in decreased expression of GCM1 protein CTD PMID:38180513 Gcm1 Rat (25R)-cholest-5-ene-3beta,26-diol multiple interactions ISO GCM1 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [27-hydroxycholesterol results in decreased expression of GCM1 protein] CTD PMID:38180513 Gcm1 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of GCM1 mRNA and Nicotine results in decreased expression of GCM1 protein CTD PMID:24368670 Gcm1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:27291303 Gcm1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gcm1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GCM1 mRNA CTD PMID:24058054 Gcm1 Rat 26-hydroxycholesterol multiple interactions ISO GCM1 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [27-hydroxycholesterol results in decreased expression of GCM1 protein] CTD PMID:38180513 Gcm1 Rat 26-hydroxycholesterol decreases expression ISO Gcm1 (Mus musculus) 6480464 27-hydroxycholesterol results in decreased expression of GCM1 protein CTD PMID:38180513 Gcm1 Rat 26-hydroxycholesterol decreases expression ISO GCM1 (Homo sapiens) 6480464 27-hydroxycholesterol results in decreased expression of GCM1 protein CTD PMID:38180513 Gcm1 Rat 3,7-dihydropurine-6-thione decreases expression EXP 6480464 Mercaptopurine results in decreased expression of GCM1 mRNA CTD PMID:23358152 Gcm1 Rat acetaldehyde affects expression ISO Gcm1 (Mus musculus) 6480464 Acetaldehyde affects the expression of GCM1 mRNA CTD PMID:22634333 Gcm1 Rat acetic acid increases expression ISO Gcm1 (Mus musculus) 6480464 Acetic Acid results in increased expression of GCM1 protein CTD PMID:21296659 Gcm1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GCM1 mRNA CTD PMID:16483693 Gcm1 Rat benzo[a]pyrene increases methylation ISO GCM1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GCM1 5' UTR and Benzo(a)pyrene results in increased methylation of GCM1 promoter CTD PMID:27901495 Gcm1 Rat benzo[a]pyrene multiple interactions ISO Gcm1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of GCM1 mRNA CTD PMID:27858113 Gcm1 Rat benzo[b]fluoranthene multiple interactions ISO Gcm1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of GCM1 mRNA CTD PMID:27858113 Gcm1 Rat benzo[e]pyrene decreases methylation ISO GCM1 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of GCM1 intron CTD PMID:30157460 Gcm1 Rat beta-naphthoflavone decreases expression ISO GCM1 (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of GCM1 mRNA CTD PMID:32858204 Gcm1 Rat bis(2-chloroethyl) sulfide increases expression ISO Gcm1 (Mus musculus) 6480464 Mustard Gas results in increased expression of GCM1 mRNA CTD PMID:15674843 Gcm1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Gcm1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of GCM1 mRNA CTD PMID:34319233 Gcm1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of GCM1 gene CTD PMID:28505145 Gcm1 Rat bisphenol A increases methylation ISO GCM1 (Homo sapiens) 6480464 bisphenol A results in increased methylation of GCM1 gene CTD PMID:31601247 Gcm1 Rat bisphenol A multiple interactions ISO GCM1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of GCM1 gene CTD PMID:31601247 Gcm1 Rat bisphenol A affects methylation ISO Gcm1 (Mus musculus) 6480464 bisphenol A affects the methylation of GCM1 promoter CTD PMID:27334623 Gcm1 Rat bromochloroacetic acid increases expression ISO Gcm1 (Mus musculus) 6480464 bromochloroacetic acid results in increased expression of GCM1 protein CTD PMID:21296659 Gcm1 Rat cadmium dichloride decreases expression ISO GCM1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of GCM1 mRNA CTD PMID:38382870 Gcm1 Rat cadmium dichloride increases expression ISO GCM1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of GCM1 mRNA CTD PMID:38568856 Gcm1 Rat carbon nanotube decreases expression ISO Gcm1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Gcm1 Rat carmustine increases expression ISO GCM1 (Homo sapiens) 6480464 Carmustine results in increased expression of GCM1 mRNA CTD PMID:15980968 Gcm1 Rat CGP 52608 multiple interactions ISO GCM1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GCM1 gene] CTD PMID:28238834 Gcm1 Rat chlorpyrifos increases expression ISO GCM1 (Homo sapiens) 6480464 Chlorpyrifos results in increased expression of GCM1 mRNA CTD PMID:22285354 Gcm1 Rat chrysene multiple interactions ISO Gcm1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of GCM1 mRNA CTD PMID:27858113 Gcm1 Rat colforsin daropate hydrochloride multiple interactions ISO GCM1 (Homo sapiens) 6480464 Colforsin promotes the reaction [GCM1 protein binds to CREBBP protein] more ... CTD PMID:16166624 and PMID:37385477 Gcm1 Rat colforsin daropate hydrochloride increases expression ISO GCM1 (Homo sapiens) 6480464 Colforsin results in increased expression of GCM1 mRNA CTD PMID:37385477 Gcm1 Rat colforsin daropate hydrochloride decreases expression ISO GCM1 (Homo sapiens) 6480464 Colforsin results in decreased expression of GCM1 mRNA CTD PMID:31278978 Gcm1 Rat cypermethrin decreases expression ISO Gcm1 (Mus musculus) 6480464 cypermethrin results in decreased expression of GCM1 mRNA CTD PMID:38582279 Gcm1 Rat Dibutyl phosphate affects expression ISO GCM1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GCM1 mRNA CTD PMID:37042841 Gcm1 Rat diisononyl phthalate decreases expression ISO Gcm1 (Mus musculus) 6480464 diisononyl phthalate results in decreased expression of GCM1 mRNA CTD PMID:37482143 Gcm1 Rat ethylparaben decreases expression ISO GCM1 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of GCM1 mRNA CTD PMID:37690743 Gcm1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of GCM1 mRNA CTD PMID:18035473 Gcm1 Rat flusilazole affects expression ISO Gcm1 (Mus musculus) 6480464 flusilazole affects the expression of GCM1 mRNA CTD PMID:22634333 Gcm1 Rat folic acid decreases expression ISO Gcm1 (Mus musculus) 6480464 Folic Acid results in decreased expression of GCM1 mRNA CTD PMID:25629700 Gcm1 Rat fulvestrant multiple interactions ISO GCM1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of GCM1 gene CTD PMID:31601247 Gcm1 Rat leflunomide increases expression ISO GCM1 (Homo sapiens) 6480464 leflunomide results in increased expression of GCM1 mRNA CTD PMID:28988120 Gcm1 Rat Licochalcone B increases expression ISO GCM1 (Homo sapiens) 6480464 licochalcone B results in increased expression of GCM1 mRNA CTD PMID:33647349 Gcm1 Rat LY294002 multiple interactions ISO GCM1 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [27-hydroxycholesterol results in decreased expression of GCM1 protein] CTD PMID:38180513 Gcm1 Rat mercaptopurine decreases expression EXP 6480464 Mercaptopurine results in decreased expression of GCM1 mRNA CTD PMID:23358152 Gcm1 Rat methapyrilene decreases methylation ISO GCM1 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of GCM1 intron CTD PMID:30157460 Gcm1 Rat methylmercury chloride increases expression ISO GCM1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of GCM1 mRNA CTD PMID:23903816 and PMID:28001369 Gcm1 Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO GCM1 (Homo sapiens) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Colforsin results in increased activity of GCM1 protein] CTD PMID:16166624 Gcm1 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of GCM1 mRNA and Nicotine results in decreased expression of GCM1 protein CTD PMID:24368670 Gcm1 Rat perfluorohexanesulfonic acid decreases expression ISO Gcm1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of GCM1 mRNA CTD PMID:37995155 Gcm1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO GCM1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of GCM1 mRNA CTD PMID:32790152 Gcm1 Rat perfluorooctanoic acid decreases expression ISO GCM1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of GCM1 mRNA CTD PMID:32790152 Gcm1 Rat purine-6-thiol decreases expression EXP 6480464 Mercaptopurine results in decreased expression of GCM1 mRNA CTD PMID:23358152 Gcm1 Rat sodium arsenite decreases expression ISO Gcm1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of GCM1 mRNA CTD PMID:37682722 Gcm1 Rat tetraphene multiple interactions ISO Gcm1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of GCM1 mRNA CTD PMID:27858113 Gcm1 Rat thiram increases expression ISO GCM1 (Homo sapiens) 6480464 Thiram results in increased expression of GCM1 mRNA CTD PMID:38568856 Gcm1 Rat titanium dioxide increases expression ISO Gcm1 (Mus musculus) 6480464 titanium dioxide results in increased expression of GCM1 mRNA CTD PMID:35295148 Gcm1 Rat trichostatin A multiple interactions ISO GCM1 (Homo sapiens) 6480464 trichostatin A promotes the reaction [Colforsin results in increased acetylation of and results in increased activity of GCM1 protein] CTD PMID:16166624 Gcm1 Rat triphenyl phosphate affects expression ISO GCM1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GCM1 mRNA CTD PMID:37042841 Gcm1 Rat urethane increases expression ISO GCM1 (Homo sapiens) 6480464 Urethane results in increased expression of GCM1 mRNA CTD PMID:28818685 Gcm1 Rat valproic acid increases methylation ISO GCM1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of GCM1 gene CTD PMID:29154799 Gcm1 Rat valproic acid increases expression ISO GCM1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of GCM1 mRNA CTD PMID:27188386 Gcm1 Rat valproic acid multiple interactions ISO GCM1 (Homo sapiens) 6480464 Valproic Acid inhibits the reaction [Colforsin results in increased expression of GCM1 mRNA] CTD PMID:37385477
Biological Process
astrocyte fate commitment (IEA,ISO) branching involved in labyrinthine layer morphogenesis (IEA,ISO) cell differentiation involved in embryonic placenta development (IBA,IEA,ISO) gliogenesis (IBA) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of syncytium formation by plasma membrane fusion (IEA,ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) regulation of cell differentiation involved in embryonic placenta development (IEA,ISO) regulation of DNA-templated transcription (IEA,ISO,TAS) regulation of transcription by RNA polymerase II (IBA) syncytium formation by plasma membrane fusion (IEA,ISO) transcription by RNA polymerase II (IEA,ISO)
Molecular Function
DNA binding (IEA,ISO) DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO) DNA-binding transcription factor activity (IEA,ISO,TAS) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA,ISO) histone deacetylase binding (IEA,ISO) metal ion binding (IEA) protein binding (ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO) sequence-specific double-stranded DNA binding (IEA,ISO) zinc ion binding (IEA,ISO)
Gcm1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 87,805,993 - 87,819,229 (+) NCBI GRCr8 mRatBN7.2 8 78,925,687 - 78,938,924 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 78,925,687 - 78,938,924 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 84,412,841 - 84,426,055 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 82,689,502 - 82,702,716 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 80,512,207 - 80,525,423 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 85,355,766 - 85,369,002 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 85,355,766 - 85,369,002 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 84,920,654 - 84,933,890 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 83,018,975 - 83,032,211 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 83,038,028 - 83,051,265 (+) NCBI Celera 8 78,670,476 - 78,683,712 (+) NCBI Celera Cytogenetic Map 8 q31 NCBI
GCM1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 53,126,961 - 53,148,841 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 53,126,961 - 53,148,841 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 52,991,759 - 53,013,639 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 53,099,721 - 53,121,586 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 53,099,720 - 53,121,586 NCBI Celera 6 54,653,553 - 54,675,420 (-) NCBI Celera Cytogenetic Map 6 p12.1 NCBI HuRef 6 52,823,388 - 52,845,251 (-) NCBI HuRef CHM1_1 6 52,993,522 - 53,015,402 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 52,966,559 - 52,988,449 (-) NCBI T2T-CHM13v2.0
Gcm1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 77,959,240 - 77,972,906 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 77,959,206 - 77,972,906 (+) Ensembl GRCm39 Ensembl GRCm38 9 78,051,958 - 78,065,624 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 78,051,924 - 78,065,624 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 77,899,765 - 77,913,431 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 77,837,642 - 77,851,308 (+) NCBI MGSCv36 mm8 Celera 9 75,229,708 - 75,242,850 (+) NCBI Celera Cytogenetic Map 9 E1 NCBI cM Map 9 43.49 NCBI
Gcm1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955411 2,898,693 - 2,917,168 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955411 2,872,758 - 2,917,154 (+) NCBI ChiLan1.0 ChiLan1.0
GCM1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 67,597,729 - 67,619,569 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 63,474,401 - 63,496,262 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 52,681,528 - 52,703,367 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 54,319,737 - 54,341,582 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 54,319,744 - 54,341,582 (-) Ensembl panpan1.1 panPan2
GCM1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 20,623,593 - 20,642,861 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 20,623,717 - 20,640,193 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 20,517,343 - 20,562,563 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 21,120,964 - 21,166,452 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 21,120,940 - 21,140,877 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 20,625,674 - 20,671,144 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 20,730,476 - 20,775,852 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 20,868,003 - 20,913,270 (-) NCBI UU_Cfam_GSD_1.0
Gcm1
GCM1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 46,767,498 - 46,791,037 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 46,767,498 - 46,798,317 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 134,509,950 - 134,516,913 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GCM1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 19,421,054 - 19,444,311 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 19,424,896 - 19,443,079 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 52,976,804 - 53,020,227 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gcm1
.
Predicted Target Of
Count of predictions: 45 Count of miRNA genes: 38 Interacting mature miRNAs: 41 Transcripts: ENSRNOT00000010583 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 10450865 Bw175 Body weight QTL 175 4.1 total fat pad mass (VT:0015008) adipose tissue molecular composition measurement (CMO:0000484) 8 75311777 84531599 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 634332 Pia18 Pristane induced arthritis QTL 18 4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 75311938 82925521 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSRNOT00000010583 ⟹ ENSRNOP00000010583
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 78,925,687 - 78,938,924 (+) Ensembl Rnor_6.0 Ensembl 8 85,355,766 - 85,369,002 (+) Ensembl
RefSeq Acc Id:
NM_017186 ⟹ NP_058882
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 87,805,993 - 87,819,229 (+) NCBI mRatBN7.2 8 78,925,687 - 78,938,924 (+) NCBI Rnor_6.0 8 85,355,766 - 85,369,002 (+) NCBI Rnor_5.0 8 84,920,654 - 84,933,890 (+) NCBI RGSC_v3.4 8 83,018,975 - 83,032,211 (+) RGD Celera 8 78,670,476 - 78,683,712 (+) RGD
Sequence:
TGAACGAGAAGGAGGGACTCAGGCCTCAGGAGCACTGAAGATGGAAAGGCTTTGAAAAACAAGCCCTTCAGCTGCTCTCGTGGACAGAGTTCTGAGACTGCGAGCTCTCGAGACATCTCTGACGATTT
hide sequence
RefSeq Acc Id:
NP_058882 ⟸ NM_017186
- UniProtKB:
Q9Z288 (UniProtKB/Swiss-Prot), A6I1H0 (UniProtKB/TrEMBL)
- Sequence:
MELDDFDPEDKEILSWDINDMKLPQNVKKTDWFQEWPDSYVKHIYSSDDRSAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCSRDCSTEEGRKIYLRPAICDKARQKQQRKSCPNCNGPLKLIPCRGH
hide sequence
Ensembl Acc Id:
ENSRNOP00000010583 ⟸ ENSRNOT00000010583
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-12-04
Gcm1
glial cells missing transcription factor 1
Gcm1
glial cells missing homolog 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-02-03
Gcm1
glial cells missing homolog 1
Gcm1
glial cells missing homolog 1 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-04-22
Gcm1
glial cells missing homolog 1 (Drosophila)
Gcma
glial cells missing (Drosophila) homolog a
Symbol and Name updated to reflect Human and Mouse nomenclature
625702 APPROVED
2002-06-10
Gcma
glial cells missing (Drosophila) homolog a
Name updated
70584 APPROVED
2001-12-06
Gcma
glial cells missing (Drosophila) homolog a
Symbol and Name updated to reflect Human and Mouse nomenclature
69665 APPROVED
Note Type
Note
Reference
gene_expression
expressed during embryonic development
61603
gene_process
transforms presumptive neurons into glia
61603
