Symbol:
Tep1
Name:
telomerase associated protein 1
RGD ID:
3869
Description:
Contributes to telomerase activity. Predicted to be involved in telomere maintenance via recombination. Part of telomerase holoenzyme complex. Human ortholog(s) of this gene implicated in hepatocellular carcinoma and stomach cancer. Orthologous to human TEP1 (telomerase associated protein 1); INTERACTS WITH 1,2,4-trimethylbenzene; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
p230; p240; p80 telomerase homolog; rTLP1; telomerase protein 1; Telomerase protein component 1; telomerase-associated protein 1; Tlp1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 26,519,429 - 26,567,073 (-) NCBI GRCr8 mRatBN7.2 15 24,045,876 - 24,093,526 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 24,045,878 - 24,093,526 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 26,817,070 - 26,864,716 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 27,775,795 - 27,823,421 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 26,025,608 - 26,073,256 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 27,751,186 - 27,798,839 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 27,751,180 - 27,798,839 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 31,583,611 - 31,631,251 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 26,802,624 - 26,852,308 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 26,818,325 - 26,868,008 (-) NCBI Celera 15 24,365,367 - 24,413,481 (-) NCBI Celera Cytogenetic Map 15 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tep1 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of TEP1 protein CTD PMID:17337753 Tep1 Rat 1,2-dimethylhydrazine decreases expression ISO Tep1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TEP1 mRNA CTD PMID:22206623 Tep1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO TEP1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TEP1 mRNA CTD PMID:17101203 Tep1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TEP1 mRNA CTD PMID:32109520 Tep1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tep1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TEP1 mRNA CTD PMID:24680724 Tep1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO TEP1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of TEP1 mRNA CTD PMID:22574217 Tep1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TEP1 mRNA CTD PMID:21346803 Tep1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of TEP1 protein CTD PMID:34915118 Tep1 Rat 4,4'-sulfonyldiphenol increases expression ISO Tep1 (Mus musculus) 6480464 bisphenol S results in increased expression of TEP1 mRNA CTD PMID:30951980 Tep1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Tep1 (Mus musculus) 6480464 Fenretinide results in decreased expression of TEP1 mRNA CTD PMID:28973697 Tep1 Rat acrolein multiple interactions ISO TEP1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of TEP1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of TEP1 mRNA CTD PMID:32699268 Tep1 Rat aflatoxin B1 increases expression ISO Tep1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of TEP1 mRNA CTD PMID:19770486 Tep1 Rat aflatoxin B1 decreases methylation ISO TEP1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TEP1 intron CTD PMID:30157460 Tep1 Rat aflatoxin B1 increases expression ISO TEP1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of TEP1 mRNA CTD PMID:21641981 and PMID:22100608 Tep1 Rat alpha-pinene multiple interactions ISO TEP1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of TEP1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of TEP1 mRNA CTD PMID:32699268 Tep1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TEP1 mRNA CTD PMID:16483693 Tep1 Rat antirheumatic drug decreases expression ISO TEP1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of TEP1 mRNA CTD PMID:24449571 Tep1 Rat aristolochic acid A increases expression ISO TEP1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TEP1 mRNA CTD PMID:33212167 Tep1 Rat arsenite(3-) multiple interactions ISO TEP1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to TEP1 mRNA] CTD PMID:32406909 Tep1 Rat benzamide decreases expression ISO TEP1 (Homo sapiens) 6480464 benzamide results in decreased expression of TEP1 mRNA and benzamide results in decreased expression of TEP1 protein CTD PMID:16098204 Tep1 Rat benzo[a]pyrene decreases expression ISO TEP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TEP1 mRNA CTD PMID:20106945 Tep1 Rat benzo[a]pyrene decreases methylation ISO Tep1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of TEP1 exon and Benzo(a)pyrene results in decreased methylation of TEP1 intron CTD PMID:27901495 Tep1 Rat benzo[a]pyrene increases methylation ISO TEP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TEP1 3' UTR CTD PMID:27901495 Tep1 Rat benzo[a]pyrene affects methylation ISO TEP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TEP1 promoter CTD PMID:27901495 Tep1 Rat benzo[a]pyrene increases expression ISO TEP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of TEP1 mRNA CTD PMID:21632981 more ... Tep1 Rat benzo[a]pyrene diol epoxide I increases expression ISO TEP1 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Tep1 Rat beta-lapachone decreases expression ISO TEP1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of TEP1 mRNA CTD PMID:38218311 Tep1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TEP1 mRNA CTD PMID:25181051 Tep1 Rat bisphenol A increases expression ISO Tep1 (Mus musculus) 6480464 bisphenol A results in increased expression of TEP1 mRNA CTD PMID:33221593 Tep1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TEP1 mRNA CTD PMID:30816183 and PMID:34947998 Tep1 Rat cadmium atom multiple interactions ISO TEP1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TEP1 mRNA CTD PMID:35301059 Tep1 Rat cadmium dichloride multiple interactions ISO TEP1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TEP1 mRNA CTD PMID:35301059 Tep1 Rat carbon nanotube decreases expression ISO Tep1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Tep1 Rat carnosic acid decreases expression ISO Tep1 (Mus musculus) 6480464 salvin results in decreased expression of TEP1 protein CTD PMID:35926579 Tep1 Rat ciguatoxin CTX1B affects expression ISO Tep1 (Mus musculus) 6480464 Ciguatoxins affects the expression of TEP1 mRNA CTD PMID:18353800 Tep1 Rat cisplatin multiple interactions ISO TEP1 (Homo sapiens) 6480464 [Cisplatin co-treated with panobinostat] affects the expression of TEP1 mRNA CTD PMID:21791302 Tep1 Rat copper(II) sulfate increases expression ISO TEP1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of TEP1 mRNA CTD PMID:19549813 Tep1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of TEP1 mRNA CTD PMID:21266533 Tep1 Rat doxorubicin decreases expression ISO TEP1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TEP1 mRNA CTD PMID:29803840 Tep1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of TEP1 mRNA CTD PMID:15353170 Tep1 Rat ethyl methanesulfonate increases expression ISO TEP1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of TEP1 mRNA CTD PMID:23649840 Tep1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of TEP1 mRNA CTD PMID:24793618 Tep1 Rat methyl methanesulfonate increases expression ISO TEP1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of TEP1 mRNA CTD PMID:23649840 Tep1 Rat ozone multiple interactions ISO TEP1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of TEP1 mRNA more ... CTD PMID:32699268 and PMID:35430440 Tep1 Rat panobinostat multiple interactions ISO TEP1 (Homo sapiens) 6480464 [Cisplatin co-treated with panobinostat] affects the expression of TEP1 mRNA CTD PMID:21791302 Tep1 Rat paracetamol affects expression ISO Tep1 (Mus musculus) 6480464 Acetaminophen affects the expression of TEP1 mRNA CTD PMID:17562736 Tep1 Rat paracetamol increases expression ISO TEP1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of TEP1 mRNA CTD PMID:22230336 Tep1 Rat paracetamol decreases expression ISO TEP1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TEP1 mRNA CTD PMID:21420995 Tep1 Rat pirinixic acid decreases expression ISO Tep1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of TEP1 mRNA CTD PMID:17426115 Tep1 Rat quercetin increases expression ISO TEP1 (Homo sapiens) 6480464 Quercetin results in increased expression of TEP1 mRNA CTD PMID:21632981 Tep1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of TEP1 mRNA CTD PMID:12325037 Tep1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of TEP1 mRNA CTD PMID:19281266 Tep1 Rat testosterone increases expression ISO TEP1 (Homo sapiens) 6480464 Testosterone results in increased expression of TEP1 mRNA CTD PMID:33359661 Tep1 Rat thiram increases expression ISO TEP1 (Homo sapiens) 6480464 Thiram results in increased expression of TEP1 mRNA CTD PMID:38568856 Tep1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of TEP1 gene CTD PMID:27618143 Tep1 Rat triphenyl phosphate affects expression ISO TEP1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TEP1 mRNA CTD PMID:37042841 Tep1 Rat tris(2-butoxyethyl) phosphate affects expression ISO TEP1 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of TEP1 mRNA CTD PMID:29024780 Tep1 Rat urethane multiple interactions ISO Tep1 (Mus musculus) 6480464 Urethane results in increased activity of [TERC protein binds to TEP1 protein binds to TERT protein] CTD PMID:11323394 Tep1 Rat urethane increases expression ISO Tep1 (Mus musculus) 6480464 Urethane results in increased expression of TEP1 mRNA and Urethane results in increased expression of TEP1 protein CTD PMID:11323394 Tep1 Rat urethane increases expression ISO TEP1 (Homo sapiens) 6480464 Urethane results in increased expression of TEP1 mRNA CTD PMID:28818685 Tep1 Rat valproic acid decreases expression ISO TEP1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TEP1 mRNA CTD PMID:28001369
1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acrolein (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) benzamide (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) carnosic acid (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) copper(II) sulfate (ISO) dibutyl phthalate (EXP) doxorubicin (ISO) ethanol (EXP) ethyl methanesulfonate (ISO) flutamide (EXP) methyl methanesulfonate (ISO) ozone (ISO) panobinostat (ISO) paracetamol (ISO) pirinixic acid (ISO) quercetin (ISO) sodium dichromate (EXP) Soman (EXP) testosterone (ISO) thiram (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) tris(2-butoxyethyl) phosphate (ISO) urethane (ISO) valproic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Two genetic variants in telomerase-associated protein 1 are associated with stomach cancer risk.
Jin DH, etal., J Hum Genet. 2016 Oct;61(10):885-889. doi: 10.1038/jhg.2016.71. Epub 2016 Jun 16.
4.
Prognostic impact of telomere maintenance gene polymorphisms on hepatocellular carcinoma patients with chronic hepatitis B.
Jung SW, etal., Hepatology. 2014 May;59(5):1912-20. doi: 10.1002/hep.26655. Epub 2014 Mar 27.
5.
RNA location and modeling of a WD40 repeat domain within the vault.
Kong LB, etal., RNA 2000 Jun;6(6):890-900.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
TLP1: a gene encoding a protein component of mammalian telomerase is a novel member of WD repeats family.
Nakayama J, etal., Cell 1997 Mar 21;88(6):875-84.
8.
In situ nucleic acid detection of human telomerase in intrahepatic cholangiocarcinoma and its preneoplastic lesion.
Ozaki S, etal., Hepatology. 1999 Oct;30(4):914-9. doi: 10.1002/hep.510300419.
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Tep1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 26,519,429 - 26,567,073 (-) NCBI GRCr8 mRatBN7.2 15 24,045,876 - 24,093,526 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 24,045,878 - 24,093,526 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 26,817,070 - 26,864,716 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 27,775,795 - 27,823,421 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 26,025,608 - 26,073,256 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 27,751,186 - 27,798,839 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 27,751,180 - 27,798,839 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 31,583,611 - 31,631,251 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 26,802,624 - 26,852,308 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 26,818,325 - 26,868,008 (-) NCBI Celera 15 24,365,367 - 24,413,481 (-) NCBI Celera Cytogenetic Map 15 p14 NCBI
TEP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 20,365,667 - 20,413,501 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 20,365,667 - 20,413,501 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 20,833,826 - 20,881,660 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 19,905,766 - 19,951,420 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 19,905,765 - 19,951,420 NCBI Celera 14 694,983 - 742,708 (-) NCBI Celera Cytogenetic Map 14 q11.2 NCBI HuRef 14 955,689 - 1,003,240 (-) NCBI HuRef CHM1_1 14 20,835,235 - 20,882,954 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 14,562,579 - 14,610,445 (-) NCBI T2T-CHM13v2.0
Tep1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 51,061,513 - 51,108,036 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 51,061,516 - 51,108,017 (-) Ensembl GRCm39 Ensembl GRCm38 14 50,824,059 - 50,870,579 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 50,824,059 - 50,870,560 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 51,443,736 - 51,490,229 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 49,745,764 - 49,792,493 (-) NCBI MGSCv36 mm8 Celera 14 47,114,946 - 47,163,125 (-) NCBI Celera Cytogenetic Map 14 C1 NCBI cM Map 14 26.26 NCBI
Tep1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955550 1,162,186 - 1,215,723 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955550 1,162,067 - 1,215,746 (-) NCBI ChiLan1.0 ChiLan1.0
TEP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 21,872,708 - 21,920,785 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 21,089,195 - 21,137,274 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 1,240,370 - 1,285,787 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 19,293,326 - 19,338,264 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 19,293,452 - 19,332,960 (-) Ensembl panpan1.1 panPan2
TEP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 17,716,887 - 17,748,485 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 17,716,887 - 17,764,356 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 18,201,865 - 18,237,404 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 17,975,936 - 18,011,501 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 17,975,936 - 18,007,251 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 17,658,710 - 17,694,422 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 17,713,441 - 17,749,086 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 17,842,350 - 17,878,168 (-) NCBI UU_Cfam_GSD_1.0
Tep1
TEP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 78,491,053 - 78,530,183 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 78,488,248 - 78,530,185 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 83,511,111 - 83,558,528 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TEP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 20,880,255 - 20,928,874 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 20,883,678 - 20,923,313 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 25,493,523 - 25,552,352 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tep1
.
Predicted Target Of
Count of predictions: 22 Count of miRNA genes: 18 Interacting mature miRNAs: 22 Transcripts: ENSRNOT00000012235 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 10755503 Bp391 Blood pressure QTL 391 2.37 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 20248600 37896129 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 5685002 Bss103 Bone structure and strength QTL 103 2.8 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 15 14481165 28469888 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 10054130 Srcrt8 Stress Responsive Cort QTL 8 2.18 0.0085 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 15 22117933 67117933 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 2324620 Coatc3 Coat color QTL 3 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 15 19856566 46187442 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 631550 Bw7 Body weight QTL 7 3.6 body mass (VT:0001259) body weight (CMO:0000012) 15 19856566 34924750 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat
TEP1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 24,066,590 - 24,066,782 (+) MAPPER mRatBN7.2 Rnor_6.0 15 27,771,900 - 27,772,091 NCBI Rnor6.0 Rnor_5.0 15 31,604,325 - 31,604,516 UniSTS Rnor5.0 RGSC_v3.4 15 26,824,799 - 26,824,990 UniSTS RGSC3.4 Celera 15 24,386,410 - 24,386,601 UniSTS Cytogenetic Map 15 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000079506 ⟹ ENSRNOP00000073225
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 24,045,878 - 24,093,526 (-) Ensembl Rnor_6.0 Ensembl 15 27,751,188 - 27,798,839 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000088981 ⟹ ENSRNOP00000068552
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 24,045,878 - 24,091,950 (-) Ensembl Rnor_6.0 Ensembl 15 27,751,180 - 27,798,408 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100610 ⟹ ENSRNOP00000078028
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 24,045,878 - 24,093,482 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105915 ⟹ ENSRNOP00000077288
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 24,045,878 - 24,093,526 (-) Ensembl
RefSeq Acc Id:
NM_022591 ⟹ NP_072113
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 26,519,429 - 26,567,073 (-) NCBI mRatBN7.2 15 24,045,876 - 24,093,526 (-) NCBI Rnor_6.0 15 27,751,186 - 27,798,839 (-) NCBI Rnor_5.0 15 31,583,611 - 31,631,251 (-) NCBI RGSC_v3.4 15 26,802,624 - 26,852,308 (-) RGD Celera 15 24,365,367 - 24,413,481 (-) RGD
Sequence:
AGCTCCGCCCCTCCCCTTGCCCAGCCTCGCCCCTTCGCCTCTCTAGGGTGTTGGTTTCCTTTCAGTTCTCTTTCTTCAACCTATCCACTGGCTGACCTAGGCCGGTTTCTGCTCCTTGTTGCGGAGAA
hide sequence
RefSeq Acc Id:
XM_039093640 ⟹ XP_038949568
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 26,519,429 - 26,544,977 (-) NCBI mRatBN7.2 15 24,045,876 - 24,071,427 (-) NCBI
RefSeq Acc Id:
XM_039093641 ⟹ XP_038949569
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 26,539,541 - 26,567,062 (-) NCBI mRatBN7.2 15 24,065,987 - 24,093,510 (-) NCBI
RefSeq Acc Id:
XM_039093642 ⟹ XP_038949570
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 26,519,429 - 26,540,162 (-) NCBI mRatBN7.2 15 24,045,876 - 24,066,610 (-) NCBI
RefSeq Acc Id:
NP_072113 ⟸ NM_022591
- UniProtKB:
O08653 (UniProtKB/Swiss-Prot), A6KEB2 (UniProtKB/TrEMBL), F1LPX8 (UniProtKB/TrEMBL)
- Sequence:
MEKLCGYVPVHPDILSLKNRCLTMLSDIQPLEKIHGQRSVNPDILSLENRCLTLLPDLQPMEKIHGQRSVHPDILSSENRCLTLLPDLQSLEKLCGHMSSHPDVLSLENRCLATLPTVKRTVSSGPLL
hide sequence
Ensembl Acc Id:
ENSRNOP00000073225 ⟸ ENSRNOT00000079506
Ensembl Acc Id:
ENSRNOP00000068552 ⟸ ENSRNOT00000088981
RefSeq Acc Id:
XP_038949568 ⟸ XM_039093640
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038949570 ⟸ XM_039093642
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038949569 ⟸ XM_039093641
- Peptide Label:
isoform X2
- UniProtKB:
A6KEB3 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000078028 ⟸ ENSRNOT00000100610
Ensembl Acc Id:
ENSRNOP00000077288 ⟸ ENSRNOT00000105915
RGD ID: 13699623 Promoter ID: EPDNEW_R10145 Type: initiation region Name: Tep1_1 Description: telomerase associated protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 27,798,776 - 27,798,836 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2003-04-09
Tep1
telomerase associated protein 1
Tlp1
Telomerase protein component 1
Symbol and Name updated
629477 APPROVED
2002-06-10
Tlp1
Telomerase protein component 1
Symbol and Name status set to approved
70586 APPROVED
