Advanced Search (OLGA)

Gene: Defb26 (defensin beta 26) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Defb26

Name:

defensin beta 26

RGD ID:

1564413

Description:

Predicted to be involved in defense response to bacterium and innate immune response. Predicted to be located in extracellular region. Orthologous to human DEFB125 (defensin beta 125); INTERACTS WITH 1,2-dimethylhydrazine; bisphenol A; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

beta-defensin 125; beta-defensin 125-like; beta-defensin 26; LOC100911232

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DEFB125 (defensin beta 125)	HGNC	Ensembl, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Defb26 (defensin beta 26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100977930 (beta-defensin 125)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DEFB125 (defensin beta 125)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Defb125 (defensin beta 125)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DEFB125 (defensin beta 125)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DEFB125 (defensin beta 125)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DEFB125 (defensin beta 125)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Defb26 (defensin beta 26)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Defb26^em1Mlit

Genetic Models:

SD-Defb26^em1Mlit

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	161,437,500 - 161,441,234 (-)	NCBI		GRCr8
mRatBN7.2	3	140,977,214 - 140,980,949 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	140,977,489 - 140,980,893 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	144,882,773 - 144,886,148 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	153,466,618 - 153,469,993 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	151,206,621 - 151,210,014 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	147,982,213 - 147,985,616 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	147,982,213 - 147,985,616 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	154,391,632 - 154,395,035 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	142,834,066 - 142,837,469 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	139,728,349 - 139,731,744 (-)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Defb26	Rat	1,2-dimethylhydrazine	multiple interactions	EXP		6480464	[APC protein affects the susceptibility to 1,2-Dimethylhydrazine] which results in decreased expression of DEFB26 mRNA	CTD	PMID:27840820
Defb26	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1342634	6480464	Benzo(a)pyrene results in increased methylation of DEFB125 promoter	CTD	PMID:27901495
Defb26	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of DEFB26 mRNA	CTD	PMID:25181051
Defb26	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of DEFB26 gene	CTD	PMID:28505145
Defb26	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of DEFB26 promoter	CTD	PMID:22457795
Defb26	Rat	CGP 52608	multiple interactions	ISO	RGD:1342634	6480464	CGP 52608 promotes the reaction [RORA protein binds to DEFB125 gene]	CTD	PMID:28238834
Defb26	Rat	epoxiconazole	increases expression	ISO	RGD:1619476	6480464	epoxiconazole results in increased expression of DEFB26 mRNA	CTD	PMID:35436446
Defb26	Rat	folic acid	increases expression	ISO	RGD:1619476	6480464	Folic Acid results in increased expression of DEFB26 mRNA	CTD	PMID:25629700
Defb26	Rat	resveratrol	multiple interactions	ISO	RGD:1342634	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of DEFB125 mRNA	CTD	PMID:23557933

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Defb26	Rat	defense response	involved_in	IEA	UniProtKB-KW:KW-0211	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Defb26	Rat	defense response to bacterium	involved_in	IEA	UniProtKB-KW:KW-0044	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Defb26	Rat	defense response to bacterium	involved_in	IEA	UniRule:UR000048414	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Defb26	Rat	defense response to bacterium	involved_in	IEA	ARBA:ARBA00028625	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Defb26	Rat	innate immune response	involved_in	IEA	InterPro:IPR025933	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Defb26	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Defb26	Rat	extracellular region	located_in	IEA	UniRule:UR000048414	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Defb26	Rat	extracellular region	located_in	IEA	InterPro:IPR025933	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Defb26	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:16033865

Defb26
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	161,437,500 - 161,441,234 (-)	NCBI		GRCr8
mRatBN7.2	3	140,977,214 - 140,980,949 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	140,977,489 - 140,980,893 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	144,882,773 - 144,886,148 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	153,466,618 - 153,469,993 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	151,206,621 - 151,210,014 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	147,982,213 - 147,985,616 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	147,982,213 - 147,985,616 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	154,391,632 - 154,395,035 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	142,834,066 - 142,837,469 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	139,728,349 - 139,731,744 (-)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

DEFB125
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	87,672 - 97,094 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	87,250 - 97,094 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	68,313 - 77,735 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	16,351 - 25,296 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	16,362 - 25,174	NCBI
Celera	20	163,193 - 172,141 (+)	NCBI		Celera
Cytogenetic Map	20	p13	NCBI
HuRef	20	21,385 - 30,334 (+)	NCBI		HuRef
CHM1_1	20	68,360 - 77,306 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	130,104 - 139,527 (+)	NCBI		T2T-CHM13v2.0

Defb26
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	152,349,490 - 152,353,662 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	152,349,718 - 152,353,612 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	152,507,756 - 152,511,736 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	152,507,798 - 152,511,692 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	152,333,492 - 152,337,472 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	152,199,239 - 152,203,133 (-)	NCBI		MGSCv36	mm8
Celera	2	158,323,236 - 158,327,152 (-)	NCBI		Celera
Cytogenetic Map	2	H1	NCBI
cM Map	2	75.18	NCBI

LOC100977930
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	146,343,038 - 146,358,954 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	146,351,826 - 146,365,641 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	20	93,610 - 102,449 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	93,610 - 102,449 (+)	Ensembl	panpan1.1		panPan2

DEFB125
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	20,743,519 - 20,757,567 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	20,743,523 - 20,820,628 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	20,390,886 - 20,404,939 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	21,431,588 - 21,445,845 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	21,431,592 - 21,445,790 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	20,707,797 - 20,721,860 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	20,812,951 - 20,826,998 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	21,243,559 - 21,257,625 (-)	NCBI		UU_Cfam_GSD_1.0

Defb125
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	169,874,544 - 169,881,917 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936485	18,305,908 - 18,320,197 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DEFB125
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	35,003,914 - 35,010,677 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	35,003,914 - 35,010,677 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	39,810,453 - 39,817,216 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DEFB125
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	35,657,282 - 35,658,996 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	35,658,224 - 35,658,640 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666078	7,440,872 - 7,442,647 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Defb26
37 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	256
Count of miRNA genes:	105
Interacting mature miRNAs:	115
Transcripts:	ENSRNOT00000070900, ENSRNOT00000073514
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	140069424	146976080	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat

This gene Defb26 is modified in the following models/strains:

SD-Defb26^em1Mlit

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

circulatory system	endocrine system	endoderm	exocrine system	hepatobiliary system	mesenchyme	mesoderm	reproductive system
2	2	2	2	2	4	2	19


RefSeq Transcripts	NM_001037506	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111428	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY621357	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GQ418166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000087431 ⟹ ENSRNOP00000071709

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	140,977,489 - 140,980,893 (-)	Ensembl
Rnor_6.0 Ensembl	3	147,982,213 - 147,985,616 (-)	Ensembl

RefSeq Acc Id:

NM_001037506 ⟹ NP_001032595

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,437,500 - 161,441,234 (-)	NCBI
mRatBN7.2	3	140,977,214 - 140,980,949 (-)	NCBI
Rnor_6.0	3	147,982,213 - 147,985,616 (-)	NCBI
Rnor_5.0	3	154,391,632 - 154,395,035 (-)	NCBI
RGSC_v3.4	3	142,834,066 - 142,837,469 (-)	RGD
Celera	3	139,728,349 - 139,731,744 (-)	RGD

Sequence:

show sequence

ATGCTTTTCCCAACACTGGCCTTCATTATCTGTGGGTTGCTAACTCAGGTGACCAAAGCTGCCTGGAGGAGAATGCCACCAAAATGCTGGAAGGATAATTTAGGGCGCTGCCGAGTCCGATGTCGAGG
TGACGAACGGTACATATATCTGTGTAGGAACAAAGCAAACTGCTGCATTCTCCTAACACTAGCGGAAGACCAAAGTGCACACCCAAAACCTACCTCGGTCCACCCAGAGAACGTGACATGGAAGAACA
CTTCCATTTCACCAACGACCAGATATATTGATGACATAACTTTGGATAAAACATCCATAGGAACGCCTACCAATGTTGCTGGCATTGGCAAGGCACTCAACCTTACAGTCATCACACCCACCCATCCC
TAG

hide sequence


Protein RefSeqs	NP_001032595	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAT51896	(Get FASTA)	NCBI Sequence Viewer
	ACU80894	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071709
	ENSRNOP00000071709.1

RefSeq Acc Id:	NP_001032595 ⟸ NM_001037506
- Peptide Label:	precursor
- UniProtKB:	Q32ZG6 (UniProtKB/TrEMBL), C8CKX5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLFPTLAFIICGLLTQVTKAAWRRMPPKCWKDNLGRCRVRCRGDERYIYLCRNKANCCILLTLAEDQSAHPKPTSVHPENVTWKNTSISPTTRYIDDITLDKTSIGTPTNVAGIGKALNLTVITPTHP hide sequence

Ensembl Acc Id:

ENSRNOP00000071709 ⟸ ENSRNOT00000087431

Protein Domains

Beta-defensin

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q32ZG6-F1-model_v2	AlphaFold	Q32ZG6	1-128	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-47266	BioCyc
Ensembl Genes	ENSRNOG00000053114	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000087431	ENTREZGENE
	ENSRNOT00000087431.2	UniProtKB/TrEMBL
InterPro	Beta-defensin	UniProtKB/TrEMBL
	Beta_defensin	UniProtKB/TrEMBL
KEGG Report	rno:641629	UniProtKB/TrEMBL
NCBI Gene	641629	ENTREZGENE
PANTHER	BETA-DEFENSIN 123-RELATED	UniProtKB/TrEMBL
	BETA-DEFENSIN 125	UniProtKB/TrEMBL
Pfam	Defensin_beta_2	UniProtKB/TrEMBL
PhenoGen	Defb26	PhenoGen
RatGTEx	ENSRNOG00000053114	RatGTEx
UniProt	C8CKX5	ENTREZGENE, UniProtKB/TrEMBL
	Q32ZG6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-29	Defb26	defensin beta 26	LOC100911232	beta-defensin 125-like	Data merged from RGD:6494431	737654	PROVISIONAL
2012-07-05	LOC100911232	beta-defensin 125-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-07	Defb26	defensin beta 26		beta-defensin 26	Name updated	1299863	APPROVED
2006-02-09	Defb26	beta-defensin 26			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message