Symbol:
Zfyve21
Name:
zinc finger FYVE-type containing 21
RGD ID:
1311036
Description:
Predicted to enable zinc ion binding activity. Predicted to be located in endosome and focal adhesion. Orthologous to human ZFYVE21 (zinc finger FYVE-type containing 21); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC362789; zinc finger FYVE domain-containing protein 21; zinc finger, FYVE domain containing 21
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 136,695,132 - 136,715,601 (+) NCBI GRCr8 mRatBN7.2 6 130,873,979 - 130,894,618 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 130,873,912 - 130,894,411 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 131,047,358 - 131,067,823 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 131,344,329 - 131,364,794 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 130,704,029 - 130,724,484 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 136,380,968 - 136,400,810 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 136,380,990 - 136,400,810 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 145,388,945 - 145,408,787 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 136,603,711 - 136,623,531 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 136,609,943 - 136,626,505 (+) NCBI Celera 6 128,427,856 - 128,447,676 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Zfyve21 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ZFYVE21 mRNA] CTD PMID:31150632 Zfyve21 Rat (1->4)-beta-D-glucan multiple interactions ISO Zfyve21 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ZFYVE21 mRNA CTD PMID:36331819 Zfyve21 Rat 1,2-dimethylhydrazine multiple interactions ISO Zfyve21 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZFYVE21 mRNA CTD PMID:22206623 Zfyve21 Rat 1,2-dimethylhydrazine decreases expression ISO Zfyve21 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ZFYVE21 mRNA CTD PMID:22206623 Zfyve21 Rat 17alpha-ethynylestradiol affects expression ISO Zfyve21 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ZFYVE21 mRNA CTD PMID:17555576 Zfyve21 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Zfyve21 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ZFYVE21 mRNA CTD PMID:19770486 Zfyve21 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ZFYVE21 mRNA CTD PMID:33387578 Zfyve21 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Zfyve21 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of ZFYVE21 mRNA CTD PMID:25975270 Zfyve21 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Zfyve21 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ZFYVE21 mRNA CTD PMID:21570461 Zfyve21 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of ZFYVE21 mRNA CTD PMID:21346803 Zfyve21 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ZFYVE21 mRNA CTD PMID:21346803 Zfyve21 Rat 2-methylcholine affects expression ISO ZFYVE21 (Homo sapiens) 6480464 beta-methylcholine affects the expression of ZFYVE21 mRNA CTD PMID:21179406 Zfyve21 Rat 4,4'-sulfonyldiphenol decreases expression ISO Zfyve21 (Mus musculus) 6480464 bisphenol S results in decreased expression of ZFYVE21 mRNA CTD PMID:39298647 Zfyve21 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ZFYVE21 mRNA CTD PMID:30047161 Zfyve21 Rat aflatoxin B1 decreases expression ISO Zfyve21 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of ZFYVE21 mRNA CTD PMID:19770486 Zfyve21 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of ZFYVE21 mRNA CTD PMID:30047161 Zfyve21 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of ZFYVE21 mRNA CTD PMID:30779732 Zfyve21 Rat antirheumatic drug increases expression ISO ZFYVE21 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of ZFYVE21 mRNA CTD PMID:24449571 Zfyve21 Rat benzo[a]pyrene decreases expression ISO Zfyve21 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ZFYVE21 mRNA CTD PMID:19770486 Zfyve21 Rat benzo[a]pyrene increases methylation ISO ZFYVE21 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ZFYVE21 promoter CTD PMID:27901495 Zfyve21 Rat benzo[e]pyrene increases methylation ISO ZFYVE21 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of ZFYVE21 intron CTD PMID:30157460 Zfyve21 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Zfyve21 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ZFYVE21 mRNA CTD PMID:34319233 Zfyve21 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ZFYVE21 mRNA CTD PMID:25181051 Zfyve21 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ZFYVE21 gene CTD PMID:28505145 Zfyve21 Rat bisphenol A decreases methylation ISO Zfyve21 (Mus musculus) 6480464 bisphenol A results in decreased methylation of ZFYVE21 promoter CTD PMID:27312807 Zfyve21 Rat carbon nanotube affects expression ISO Zfyve21 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of ZFYVE21 mRNA CTD PMID:25554681 Zfyve21 Rat carbon nanotube decreases expression ISO Zfyve21 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of ZFYVE21 mRNA CTD PMID:25554681 Zfyve21 Rat chlordecone increases expression ISO Zfyve21 (Mus musculus) 6480464 Chlordecone results in increased expression of ZFYVE21 mRNA CTD PMID:33711761 Zfyve21 Rat chlorpyrifos increases expression ISO Zfyve21 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ZFYVE21 mRNA CTD PMID:37019170 Zfyve21 Rat copper(II) sulfate decreases expression ISO ZFYVE21 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ZFYVE21 mRNA CTD PMID:19549813 Zfyve21 Rat cyclosporin A decreases expression ISO ZFYVE21 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ZFYVE21 mRNA CTD PMID:25562108 and PMID:27989131 Zfyve21 Rat Dibutyl phosphate affects expression ISO ZFYVE21 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ZFYVE21 mRNA CTD PMID:37042841 Zfyve21 Rat dibutyl phthalate decreases expression ISO Zfyve21 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of ZFYVE21 mRNA CTD PMID:21266533 Zfyve21 Rat doxorubicin increases expression ISO ZFYVE21 (Homo sapiens) 6480464 Doxorubicin results in increased expression of ZFYVE21 mRNA CTD PMID:29803840 Zfyve21 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of ZFYVE21 mRNA CTD PMID:29391264 Zfyve21 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of ZFYVE21 mRNA CTD PMID:24136188 Zfyve21 Rat folic acid multiple interactions ISO Zfyve21 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZFYVE21 mRNA CTD PMID:22206623 Zfyve21 Rat folic acid decreases expression ISO Zfyve21 (Mus musculus) 6480464 Folic Acid results in decreased expression of ZFYVE21 mRNA CTD PMID:25629700 Zfyve21 Rat FR900359 decreases phosphorylation ISO ZFYVE21 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of ZFYVE21 protein CTD PMID:37730182 Zfyve21 Rat inulin multiple interactions ISO Zfyve21 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ZFYVE21 mRNA CTD PMID:36331819 Zfyve21 Rat leflunomide decreases expression ISO ZFYVE21 (Homo sapiens) 6480464 leflunomide results in decreased expression of ZFYVE21 mRNA CTD PMID:28988120 Zfyve21 Rat menadione affects expression ISO ZFYVE21 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of ZFYVE21 mRNA CTD PMID:20044591 Zfyve21 Rat methapyrilene increases methylation ISO ZFYVE21 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of ZFYVE21 intron CTD PMID:30157460 Zfyve21 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of ZFYVE21 mRNA CTD PMID:30467583 Zfyve21 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of ZFYVE21 mRNA CTD PMID:30047161 Zfyve21 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Zfyve21 (Mus musculus) 6480464 [MYBPC3 protein affects the susceptibility to benzyloxycarbonylleucyl-leucyl-leucine aldehyde] which results in decreased expression of ZFYVE21 mRNA CTD PMID:25566086 Zfyve21 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of ZFYVE21 mRNA CTD PMID:24136188 Zfyve21 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ZFYVE21 mRNA CTD PMID:25729387 Zfyve21 Rat paracetamol affects expression ISO Zfyve21 (Mus musculus) 6480464 Acetaminophen affects the expression of ZFYVE21 mRNA CTD PMID:17562736 Zfyve21 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Zfyve21 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ZFYVE21 mRNA more ... CTD PMID:36331819 Zfyve21 Rat pirinixic acid multiple interactions ISO Zfyve21 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of ZFYVE21 mRNA CTD PMID:19710929 Zfyve21 Rat potassium dichromate increases expression ISO ZFYVE21 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of ZFYVE21 protein CTD PMID:23718831 Zfyve21 Rat propiconazole decreases expression ISO Zfyve21 (Mus musculus) 6480464 propiconazole results in decreased expression of ZFYVE21 mRNA CTD PMID:21278054 Zfyve21 Rat silicon dioxide decreases expression ISO Zfyve21 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of ZFYVE21 mRNA CTD PMID:19073995 Zfyve21 Rat sodium arsenite decreases expression ISO ZFYVE21 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ZFYVE21 mRNA CTD PMID:38568856 Zfyve21 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of ZFYVE21 mRNA CTD PMID:19281266 Zfyve21 Rat succimer multiple interactions ISO Zfyve21 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of ZFYVE21 mRNA and [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of ZFYVE21 mRNA CTD PMID:21641980 and PMID:26378955 Zfyve21 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of ZFYVE21 mRNA CTD PMID:30047161 Zfyve21 Rat tamoxifen affects expression ISO Zfyve21 (Mus musculus) 6480464 Tamoxifen affects the expression of ZFYVE21 mRNA CTD PMID:17555576 Zfyve21 Rat temozolomide increases expression ISO ZFYVE21 (Homo sapiens) 6480464 Temozolomide results in increased expression of ZFYVE21 mRNA CTD PMID:31758290 Zfyve21 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ZFYVE21 mRNA CTD PMID:31150632 Zfyve21 Rat tetrachloromethane decreases expression ISO Zfyve21 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ZFYVE21 mRNA CTD PMID:31919559 Zfyve21 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ZFYVE21 mRNA] CTD PMID:31150632 Zfyve21 Rat tetraphene increases expression ISO Zfyve21 (Mus musculus) 6480464 benz(a)anthracene results in increased expression of ZFYVE21 mRNA CTD PMID:26377693 Zfyve21 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ZFYVE21 mRNA CTD PMID:34492290 Zfyve21 Rat titanium dioxide decreases expression ISO Zfyve21 (Mus musculus) 6480464 titanium dioxide results in decreased expression of ZFYVE21 mRNA CTD PMID:23557971 Zfyve21 Rat titanium dioxide decreases methylation ISO Zfyve21 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ZFYVE21 gene and titanium dioxide results in decreased methylation of ZFYVE21 promoter alternative form CTD PMID:35295148 Zfyve21 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ZFYVE21 mRNA CTD PMID:25729387 Zfyve21 Rat tungsten increases expression ISO Zfyve21 (Mus musculus) 6480464 Tungsten results in increased expression of ZFYVE21 mRNA CTD PMID:30912803 Zfyve21 Rat tunicamycin decreases expression ISO ZFYVE21 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of ZFYVE21 mRNA CTD PMID:29453283 Zfyve21 Rat valproic acid affects expression ISO Zfyve21 (Mus musculus) 6480464 Valproic Acid affects the expression of ZFYVE21 mRNA CTD PMID:17292431 Zfyve21 Rat valproic acid decreases expression ISO ZFYVE21 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ZFYVE21 mRNA CTD PMID:29154799
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2,4-dinitrotoluene (EXP) 2-methylcholine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) amitrole (EXP) amphetamine (EXP) antirheumatic drug (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) carbon nanotube (ISO) chlordecone (ISO) chlorpyrifos (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) doxorubicin (ISO) endosulfan (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) inulin (ISO) leflunomide (ISO) menadione (ISO) methapyrilene (EXP,ISO) methimazole (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nefazodone (EXP) oxaliplatin (EXP) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) potassium dichromate (ISO) propiconazole (ISO) silicon dioxide (ISO) sodium arsenite (ISO) Soman (EXP) succimer (ISO) sulfadimethoxine (EXP) tamoxifen (ISO) temozolomide (ISO) tetrachloromethane (EXP,ISO) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) tungsten (ISO) tunicamycin (ISO) valproic acid (ISO)
Zfyve21 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 136,695,132 - 136,715,601 (+) NCBI GRCr8 mRatBN7.2 6 130,873,979 - 130,894,618 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 130,873,912 - 130,894,411 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 131,047,358 - 131,067,823 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 131,344,329 - 131,364,794 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 130,704,029 - 130,724,484 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 136,380,968 - 136,400,810 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 136,380,990 - 136,400,810 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 145,388,945 - 145,408,787 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 136,603,711 - 136,623,531 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 136,609,943 - 136,626,505 (+) NCBI Celera 6 128,427,856 - 128,447,676 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
ZFYVE21 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 103,715,810 - 103,733,664 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 103,715,730 - 103,733,668 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 104,182,147 - 104,200,001 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 103,251,898 - 103,269,752 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 103,251,897 - 103,269,751 NCBI Celera 14 84,236,401 - 84,254,256 (+) NCBI Celera Cytogenetic Map 14 q32.33 NCBI HuRef 14 84,360,391 - 84,378,316 (+) NCBI HuRef CHM1_1 14 104,120,235 - 104,138,173 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 97,951,867 - 97,969,731 (+) NCBI T2T-CHM13v2.0
Zfyve21 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 111,780,600 - 111,794,822 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 111,780,604 - 111,798,626 (+) Ensembl GRCm39 Ensembl GRCm38 12 111,814,166 - 111,828,388 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 111,814,170 - 111,832,192 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 113,052,481 - 113,066,287 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 112,262,048 - 112,276,194 (+) NCBI MGSCv36 mm8 Celera 12 113,018,844 - 113,036,868 (+) NCBI Celera Cytogenetic Map 12 F1 NCBI cM Map 12 61.14 NCBI
Zfyve21 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955538 2,509,506 - 2,519,676 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955538 2,509,506 - 2,519,682 (+) NCBI ChiLan1.0 ChiLan1.0
ZFYVE21 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 104,874,979 - 104,892,848 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 104,091,481 - 104,109,354 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 84,341,941 - 84,359,831 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 104,161,904 - 104,168,787 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 104,161,904 - 104,168,787 (+) Ensembl panpan1.1 panPan2
ZFYVE21 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 71,451,968 - 71,462,244 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 71,451,999 - 71,461,938 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 70,965,098 - 70,975,370 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 71,730,727 - 71,741,005 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 71,730,738 - 71,741,005 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 71,419,386 - 71,429,952 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 71,459,814 - 71,470,377 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 71,858,469 - 71,868,979 (+) NCBI UU_Cfam_GSD_1.0
Zfyve21 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 2,618,502 - 2,633,222 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936621 1,446,099 - 1,462,219 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936621 1,447,459 - 1,462,179 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ZFYVE21 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa10.2 7 130,821,382 - 130,829,315 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ZFYVE21 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 81,644,466 - 81,663,017 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 81,644,493 - 81,662,376 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 68,958,017 - 68,976,595 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Zfyve21
.
Predicted Target Of
Count of predictions: 146 Count of miRNA genes: 123 Interacting mature miRNAs: 131 Transcripts: ENSRNOT00000063865 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 1641917 Colcr5 Colorectal carcinoma resistance QTL 5 3.18 0.0009 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 6 122549046 137801795 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 61329 Eae9 Experimental allergic encephalomyelitis QTL 9 3.7 body mass (VT:0001259) change in body weight (CMO:0002045) 6 122549046 140994061 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 2312560 Pur20 Proteinuria QTL 20 2.1 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 125628133 137801795 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat 2293085 Iddm29 Insulin dependent diabetes mellitus QTL 29 7.66 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 6 122549046 140286318 Rat
C85416
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 130,890,241 - 130,890,433 (+) MAPPER mRatBN7.2 Rnor_6.0 6 136,397,221 - 136,397,412 NCBI Rnor6.0 Rnor_5.0 6 145,405,198 - 145,405,389 UniSTS Rnor5.0 RGSC_v3.4 6 136,619,942 - 136,620,133 UniSTS RGSC3.4 Celera 6 128,444,087 - 128,444,278 UniSTS Cytogenetic Map 6 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000063865 ⟹ ENSRNOP00000059837
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 130,874,009 - 130,890,616 (+) Ensembl Rnor_6.0 Ensembl 6 136,380,990 - 136,400,810 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000082914 ⟹ ENSRNOP00000074963
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 130,873,912 - 130,890,610 (+) Ensembl Rnor_6.0 Ensembl 6 136,380,995 - 136,397,228 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000094351 ⟹ ENSRNOP00000092004
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 130,873,912 - 130,894,411 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097439 ⟹ ENSRNOP00000090894
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 130,873,912 - 130,894,411 (+) Ensembl
RefSeq Acc Id:
NM_001108725 ⟹ NP_001102195
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,695,151 - 136,715,601 (+) NCBI mRatBN7.2 6 130,873,999 - 130,894,449 (+) NCBI Rnor_6.0 6 136,380,990 - 136,400,810 (+) NCBI Rnor_5.0 6 145,388,945 - 145,408,787 (+) NCBI RGSC_v3.4 6 136,603,711 - 136,623,531 (+) RGD Celera 6 128,427,856 - 128,447,676 (+) RGD
Sequence:
GTGTGGGCTCAGCGCGGGCGGTGGCGTGAGGGGCTCAGGAGGAGACATGTCCTCGGGGGTGGCCGCGCGTTGCGACGCCAAGAAGCTTGTGCGCTCGCCCAGTGGCCTGCGCATGGTGCCGGAGCACC
hide sequence
RefSeq Acc Id:
NM_001399738 ⟹ NP_001386667
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,695,151 - 136,711,240 (+) NCBI mRatBN7.2 6 130,873,999 - 130,890,088 (+) NCBI
RefSeq Acc Id:
NM_001399739 ⟹ NP_001386668
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,695,151 - 136,711,403 (+) NCBI mRatBN7.2 6 130,873,999 - 130,890,251 (+) NCBI
RefSeq Acc Id:
NM_001399740 ⟹ NP_001386669
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,695,151 - 136,715,601 (+) NCBI mRatBN7.2 6 130,873,999 - 130,894,449 (+) NCBI
RefSeq Acc Id:
NR_174344
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,695,151 - 136,711,768 (+) NCBI mRatBN7.2 6 130,873,999 - 130,890,616 (+) NCBI
RefSeq Acc Id:
XM_006240639 ⟹ XP_006240701
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,695,134 - 136,711,770 (+) NCBI mRatBN7.2 6 130,873,980 - 130,890,618 (+) NCBI Rnor_6.0 6 136,380,968 - 136,397,599 (+) NCBI Rnor_5.0 6 145,388,945 - 145,408,787 (+) NCBI
Sequence:
GGGCGGAGCGGGGTGGCGACCTGTGTGGGCTCAGCGCGGGCGGTGGCGTGAGGGGCTCAGGAGG
hide sequence
RefSeq Acc Id:
XM_006240641 ⟹ XP_006240703
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,695,135 - 136,711,770 (+) NCBI mRatBN7.2 6 130,873,980 - 130,890,618 (+) NCBI Rnor_6.0 6 136,380,968 - 136,397,599 (+) NCBI Rnor_5.0 6 145,388,945 - 145,408,787 (+) NCBI
Sequence:
GGGCGGAGCGGGGTGGCGACCTGTGTGGGCTCAGCGCGGGCGGTGGCGTGAGGGGCTCAGGAGG
hide sequence
RefSeq Acc Id:
XM_017594235 ⟹ XP_017449724
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,695,134 - 136,711,770 (+) NCBI mRatBN7.2 6 130,873,980 - 130,890,618 (+) NCBI Rnor_6.0 6 136,380,968 - 136,397,599 (+) NCBI
Sequence:
GGGCGGAGCGGGGTGGCGACCTGTGTGGGCTCAGCGCGGGCGGTGGCGTGAGGGGCTCAGGAGG
hide sequence
RefSeq Acc Id:
XM_017594236 ⟹ XP_017449725
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,695,132 - 136,711,770 (+) NCBI mRatBN7.2 6 130,873,980 - 130,890,618 (+) NCBI Rnor_6.0 6 136,380,968 - 136,397,599 (+) NCBI
Sequence:
GGGCGGAGCGGGGTGGCGACCTGTGTGGGCTCAGCGCGGGCGGTGGCGTGAGGGGCTCAGGAGG
hide sequence
RefSeq Acc Id:
XM_017594237 ⟹ XP_017449726
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,695,132 - 136,715,559 (+) NCBI mRatBN7.2 6 130,873,979 - 130,894,618 (+) NCBI Rnor_6.0 6 136,380,968 - 136,400,776 (+) NCBI
Sequence:
GGGCGGAGCGGGGTGGCGACCTGTGTGGGCTCAGCGCGGGCGGTGGCGTGAGGGGCTCAGGAGG
hide sequence
RefSeq Acc Id:
XM_063262148 ⟹ XP_063118218
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,695,132 - 136,715,559 (+) NCBI
RefSeq Acc Id:
XM_063262149 ⟹ XP_063118219
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 136,695,132 - 136,715,559 (+) NCBI
RefSeq Acc Id:
NP_001102195 ⟸ NM_001108725
- Peptide Label:
isoform 2
- UniProtKB:
A6KBT7 (UniProtKB/TrEMBL), A0A8I6AFN3 (UniProtKB/TrEMBL)
- Sequence:
MSSGVAARCDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECPRCMQCDAKFDFITRKHHCRRCGKCFCDRCCSQKVPLRRMCFVDPVRQCADCALVSHREAEFYDKQLKVLVSGATFLVTFG
hide sequence
RefSeq Acc Id:
XP_006240701 ⟸ XM_006240639
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K9E1 (UniProtKB/TrEMBL)
- Sequence:
MSSGVAARCDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECPRCMQCDAKFDFITRKHHCRRCGKCFCDRCCSQKVPLRRMCFVDPVRQCADCALVSHREAEFYDKQLKVLVSGATFLVTFG
hide sequence
RefSeq Acc Id:
XP_006240703 ⟸ XM_006240641
- Peptide Label:
isoform X5
- UniProtKB:
A0A0G2K9E1 (UniProtKB/TrEMBL)
- Sequence:
MSSGVAARCDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECPRCMQCDAKFDFITRKHHCRRCGKCFCDRCCSQKVPLRRMCFVDPVRQCADCALVSHREAEFYDKQLKVLVSGATFLVTFG
hide sequence
RefSeq Acc Id:
XP_017449726 ⟸ XM_017594237
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6AAK3 (UniProtKB/TrEMBL)
- Sequence:
MSSGVAARCDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECPRCMQCDAKFDFITRKHHCRRCGKCFCDRCCSQKVPLRRMCFVDPVRQCADCALVSHREAEFYDKQLKVLVSGATFLVTFG
hide sequence
RefSeq Acc Id:
XP_017449724 ⟸ XM_017594235
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K9E1 (UniProtKB/TrEMBL)
- Sequence:
MSSGVAARCDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECPRCMQCDAKFDFITRKHHCRRCGKCFCDRCCSQKVPLRRMCFVDPVRQCADCALVSHREAEFYDKQLKVLVSGATFLVTFG
hide sequence
RefSeq Acc Id:
XP_017449725 ⟸ XM_017594236
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K9E1 (UniProtKB/TrEMBL)
- Sequence:
MSSGVAARCDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECPRCMQCDAKFDFITRKHHCRRCGKCFCDRCCSQKVPLRRMCFVDPVRQCADCALVSHREAEFYDKQLKVLVSGATFLVTFG
hide sequence
Ensembl Acc Id:
ENSRNOP00000074963 ⟸ ENSRNOT00000082914
Ensembl Acc Id:
ENSRNOP00000059837 ⟸ ENSRNOT00000063865
Ensembl Acc Id:
ENSRNOP00000092004 ⟸ ENSRNOT00000094351
Ensembl Acc Id:
ENSRNOP00000090894 ⟸ ENSRNOT00000097439
RefSeq Acc Id:
NP_001386669 ⟸ NM_001399740
- Peptide Label:
isofrm 4
- UniProtKB:
A0A8I6AFN3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386668 ⟸ NM_001399739
- Peptide Label:
isoform 3
- UniProtKB:
D3ZRQ5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386667 ⟸ NM_001399738
- Peptide Label:
isoform 1
- UniProtKB:
D3ZVP7 (UniProtKB/Swiss-Prot), D3ZRQ5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118218 ⟸ XM_063262148
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I6AAK3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118219 ⟸ XM_063262149
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6AAK3 (UniProtKB/TrEMBL)
RGD ID: 13694851 Promoter ID: EPDNEW_R5371 Type: initiation region Name: Zfyve21_1 Description: zinc finger FYVE-type containing 21 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 136,381,026 - 136,381,086 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-19
Zfyve21
zinc finger FYVE-type containing 21
Zfyve21
zinc finger, FYVE domain containing 21
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Zfyve21
zinc finger, FYVE domain containing 21
Zfyve21_predicted
zinc finger, FYVE domain containing 21 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Zfyve21_predicted
zinc finger, FYVE domain containing 21 (predicted)
Symbol and Name status set to approved
70820 APPROVED
