Symbol:
Arrdc2
Name:
arrestin domain containing 2
RGD ID:
1309659
Description:
Predicted to be involved in protein transport. Predicted to be located in cytoplasmic vesicle. Predicted to be active in cytoplasm and plasma membrane. Orthologous to human ARRDC2 (arrestin domain containing 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
arrestin domain-containing protein 2; ILAD1; induced by lysergic acid diethylamide-1; LOC306344
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 18,635,883 - 18,640,019 (+) NCBI GRCr8 mRatBN7.2 16 18,601,897 - 18,606,029 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 18,601,897 - 18,606,029 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 18,644,079 - 18,648,207 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 19,776,755 - 19,780,883 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 18,697,019 - 18,701,147 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 20,352,480 - 20,356,612 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 20,352,480 - 20,356,612 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 20,209,578 - 20,213,710 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 19,108,344 - 19,112,480 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 19,108,559 - 19,113,938 (+) NCBI Celera 16 18,793,987 - 18,798,119 (+) NCBI Celera Cytogenetic Map 16 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Arrdc2 Rat (1->4)-beta-D-glucan multiple interactions ISO Arrdc2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ARRDC2 mRNA CTD PMID:36331819 Arrdc2 Rat 1,2-dichloroethane decreases expression ISO Arrdc2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of ARRDC2 mRNA CTD PMID:28189721 and PMID:28960355 Arrdc2 Rat 1,2-dimethylhydrazine increases expression ISO Arrdc2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ARRDC2 mRNA CTD PMID:22206623 Arrdc2 Rat 17beta-estradiol affects expression ISO Arrdc2 (Mus musculus) 6480464 Estradiol affects the expression of ARRDC2 mRNA CTD PMID:39298647 Arrdc2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO ARRDC2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARRDC2 mRNA CTD PMID:20106945 Arrdc2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ARRDC2 mRNA CTD PMID:33387578 Arrdc2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide] results in decreased expression of ARRDC2 mRNA CTD PMID:29704546 Arrdc2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Arrdc2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ARRDC2 mRNA CTD PMID:21570461 Arrdc2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Arrdc2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARRDC2 mRNA CTD PMID:19465110 and PMID:19770486 Arrdc2 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of ARRDC2 mRNA CTD PMID:28522335 Arrdc2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ARRDC2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ARRDC2 mRNA CTD PMID:28628672 Arrdc2 Rat 4,4'-sulfonyldiphenol affects expression ISO Arrdc2 (Mus musculus) 6480464 bisphenol S affects the expression of ARRDC2 mRNA CTD PMID:39298647 Arrdc2 Rat 4-hydroxyphenyl retinamide increases expression ISO Arrdc2 (Mus musculus) 6480464 Fenretinide results in increased expression of ARRDC2 mRNA CTD PMID:28973697 Arrdc2 Rat 5-aza-2'-deoxycytidine affects expression ISO ARRDC2 (Homo sapiens) 6480464 Decitabine affects the expression of ARRDC2 mRNA CTD PMID:23300844 Arrdc2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ARRDC2 mRNA CTD PMID:24780913 Arrdc2 Rat acrylamide increases expression ISO ARRDC2 (Homo sapiens) 6480464 Acrylamide results in increased expression of ARRDC2 mRNA CTD PMID:32763439 Arrdc2 Rat aflatoxin B1 increases expression ISO Arrdc2 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of ARRDC2 mRNA CTD PMID:19770486 Arrdc2 Rat aflatoxin B1 decreases methylation ISO ARRDC2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ARRDC2 promoter CTD PMID:30157460 Arrdc2 Rat aflatoxin B1 decreases expression ISO ARRDC2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ARRDC2 mRNA CTD PMID:27153756 Arrdc2 Rat all-trans-retinoic acid decreases expression ISO ARRDC2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of ARRDC2 mRNA CTD PMID:23724009 Arrdc2 Rat all-trans-retinoic acid increases expression ISO ARRDC2 (Homo sapiens) 6480464 Tretinoin results in increased expression of ARRDC2 mRNA CTD PMID:33167477 Arrdc2 Rat aristolochic acid A increases expression ISO ARRDC2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ARRDC2 mRNA CTD PMID:33212167 Arrdc2 Rat arsenous acid increases expression ISO Arrdc2 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of ARRDC2 mRNA CTD PMID:35676786 Arrdc2 Rat azathioprine increases expression ISO ARRDC2 (Homo sapiens) 6480464 Azathioprine results in increased expression of ARRDC2 mRNA CTD PMID:22623647 Arrdc2 Rat benzene increases expression ISO ARRDC2 (Homo sapiens) 6480464 Benzene results in increased expression of ARRDC2 mRNA CTD PMID:19162166 Arrdc2 Rat benzo[a]pyrene decreases expression ISO ARRDC2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ARRDC2 mRNA CTD PMID:20106945 Arrdc2 Rat benzo[a]pyrene increases methylation ISO ARRDC2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ARRDC2 promoter CTD PMID:27901495 Arrdc2 Rat benzo[a]pyrene increases expression ISO ARRDC2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ARRDC2 mRNA CTD PMID:26238291 and PMID:32234424 Arrdc2 Rat benzo[a]pyrene increases expression ISO Arrdc2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ARRDC2 mRNA CTD PMID:21569818 more ... Arrdc2 Rat benzo[a]pyrene decreases expression ISO Arrdc2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ARRDC2 mRNA CTD PMID:19770486 Arrdc2 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of ARRDC2 mRNA CTD PMID:18164116 Arrdc2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ARRDC2 mRNA CTD PMID:25181051 Arrdc2 Rat bisphenol A multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ARRDC2 mRNA CTD PMID:28628672 Arrdc2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ARRDC2 mRNA CTD PMID:30816183 Arrdc2 Rat bisphenol F multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ARRDC2 mRNA CTD PMID:28628672 Arrdc2 Rat bisphenol F decreases expression ISO Arrdc2 (Mus musculus) 6480464 bisphenol F results in decreased expression of ARRDC2 mRNA CTD PMID:38685157 Arrdc2 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of ARRDC2 mRNA CTD PMID:19167457 Arrdc2 Rat cadmium atom multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ARRDC2 mRNA CTD PMID:29741670 Arrdc2 Rat cadmium dichloride multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ARRDC2 mRNA CTD PMID:29741670 Arrdc2 Rat carbon nanotube decreases expression ISO Arrdc2 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of ARRDC2 mRNA CTD PMID:25554681 Arrdc2 Rat carbon nanotube affects expression ISO Arrdc2 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of ARRDC2 mRNA CTD PMID:25554681 and PMID:25620056 Arrdc2 Rat carmustine affects response to substance ISO ARRDC2 (Homo sapiens) 6480464 ARRDC2 mRNA affects the susceptibility to Carmustine CTD PMID:16365179 Arrdc2 Rat chloroprene increases expression ISO Arrdc2 (Mus musculus) 6480464 Chloroprene results in increased expression of ARRDC2 mRNA CTD PMID:23125180 Arrdc2 Rat choline multiple interactions ISO Arrdc2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of ARRDC2 mRNA CTD PMID:20938992 Arrdc2 Rat cisplatin affects expression ISO ARRDC2 (Homo sapiens) 6480464 Cisplatin affects the expression of ARRDC2 mRNA CTD PMID:23300844 Arrdc2 Rat copper(II) chloride decreases expression ISO ARRDC2 (Homo sapiens) 6480464 cupric chloride results in decreased expression of ARRDC2 mRNA CTD PMID:38568856 Arrdc2 Rat copper(II) sulfate increases expression ISO ARRDC2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ARRDC2 mRNA CTD PMID:19549813 Arrdc2 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of ARRDC2 mRNA CTD PMID:27523638 Arrdc2 Rat cyclosporin A decreases expression ISO ARRDC2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ARRDC2 mRNA CTD PMID:20106945 Arrdc2 Rat cyclosporin A increases expression ISO ARRDC2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ARRDC2 mRNA CTD PMID:25562108 Arrdc2 Rat dexamethasone multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ARRDC2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ARRDC2 mRNA CTD PMID:28628672 Arrdc2 Rat diarsenic trioxide increases expression ISO Arrdc2 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of ARRDC2 mRNA CTD PMID:35676786 Arrdc2 Rat diazinon increases methylation ISO ARRDC2 (Homo sapiens) 6480464 Diazinon results in increased methylation of ARRDC2 gene CTD PMID:22964155 Arrdc2 Rat diethyl maleate decreases expression EXP 6480464 diethyl maleate results in decreased expression of ARRDC2 mRNA CTD PMID:21161181 Arrdc2 Rat dorsomorphin multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Arrdc2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ARRDC2 mRNA CTD PMID:29391264 Arrdc2 Rat epoxiconazole decreases expression ISO Arrdc2 (Mus musculus) 6480464 epoxiconazole results in decreased expression of ARRDC2 mRNA CTD PMID:35436446 Arrdc2 Rat ethanol affects expression ISO Arrdc2 (Mus musculus) 6480464 Ethanol affects the expression of ARRDC2 mRNA CTD PMID:30319688 Arrdc2 Rat folic acid multiple interactions ISO Arrdc2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of ARRDC2 mRNA CTD PMID:20938992 Arrdc2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ARRDC2 mRNA CTD PMID:33387578 Arrdc2 Rat glyphosate increases expression ISO Arrdc2 (Mus musculus) 6480464 Glyphosate results in increased expression of ARRDC2 mRNA CTD PMID:35897073 Arrdc2 Rat hydrogen sulfide increases expression ISO Arrdc2 (Mus musculus) 6480464 Hydrogen Sulfide results in increased expression of ARRDC2 mRNA CTD PMID:31843631 Arrdc2 Rat indometacin multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ARRDC2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ARRDC2 mRNA CTD PMID:28628672 Arrdc2 Rat isoprenaline increases expression ISO Arrdc2 (Mus musculus) 6480464 Isoproterenol results in increased expression of ARRDC2 mRNA CTD PMID:20003209 Arrdc2 Rat L-methionine multiple interactions ISO Arrdc2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of ARRDC2 mRNA CTD PMID:20938992 Arrdc2 Rat lead(0) affects expression ISO ARRDC2 (Homo sapiens) 6480464 Lead affects the expression of ARRDC2 mRNA CTD PMID:28903495 Arrdc2 Rat menadione affects expression ISO ARRDC2 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of ARRDC2 mRNA CTD PMID:20044591 Arrdc2 Rat mercury dibromide decreases expression ISO ARRDC2 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of ARRDC2 mRNA CTD PMID:26272509 Arrdc2 Rat mercury dibromide multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ARRDC2 mRNA CTD PMID:27188386 Arrdc2 Rat methamphetamine increases expression ISO Arrdc2 (Mus musculus) 6480464 Methamphetamine results in increased expression of ARRDC2 mRNA CTD PMID:26307267 Arrdc2 Rat methyl methanesulfonate increases expression ISO ARRDC2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of ARRDC2 mRNA CTD PMID:23649840 Arrdc2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of ARRDC2 mRNA CTD PMID:18164116 Arrdc2 Rat niclosamide increases expression ISO ARRDC2 (Homo sapiens) 6480464 Niclosamide results in increased expression of ARRDC2 mRNA CTD PMID:36318118 Arrdc2 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of ARRDC2 mRNA CTD PMID:23665939 Arrdc2 Rat ozone multiple interactions ISO Arrdc2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of ARRDC2 mRNA CTD PMID:34911549 Arrdc2 Rat paracetamol affects expression ISO Arrdc2 (Mus musculus) 6480464 Acetaminophen affects the expression of ARRDC2 mRNA CTD PMID:17562736 Arrdc2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ARRDC2 mRNA CTD PMID:33387578 Arrdc2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Arrdc2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ARRDC2 mRNA CTD PMID:36331819 Arrdc2 Rat phenobarbital increases expression ISO Arrdc2 (Mus musculus) 6480464 Phenobarbital results in increased expression of ARRDC2 mRNA CTD PMID:19270015 Arrdc2 Rat phenobarbital affects expression ISO Arrdc2 (Mus musculus) 6480464 Phenobarbital affects the expression of ARRDC2 mRNA CTD PMID:23091169 Arrdc2 Rat phenylmercury acetate decreases expression ISO ARRDC2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of ARRDC2 mRNA CTD PMID:26272509 Arrdc2 Rat phenylmercury acetate multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ARRDC2 mRNA CTD PMID:27188386 Arrdc2 Rat pirinixic acid multiple interactions ISO Arrdc2 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of ARRDC2 mRNA CTD PMID:19710929 Arrdc2 Rat propiconazole decreases expression ISO Arrdc2 (Mus musculus) 6480464 propiconazole results in decreased expression of ARRDC2 mRNA CTD PMID:21278054 Arrdc2 Rat quercetin increases expression ISO ARRDC2 (Homo sapiens) 6480464 Quercetin results in increased expression of ARRDC2 mRNA CTD PMID:21632981 Arrdc2 Rat SB 431542 multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Arrdc2 Rat sunitinib increases expression ISO ARRDC2 (Homo sapiens) 6480464 Sunitinib results in increased expression of ARRDC2 mRNA CTD PMID:31533062 Arrdc2 Rat tamoxifen increases expression ISO Arrdc2 (Mus musculus) 6480464 Tamoxifen results in increased expression of ARRDC2 mRNA CTD PMID:25123088 Arrdc2 Rat temozolomide affects response to substance ISO ARRDC2 (Homo sapiens) 6480464 ARRDC2 mRNA affects the susceptibility to temozolomide CTD PMID:16365179 Arrdc2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ARRDC2 mRNA CTD PMID:31150632 Arrdc2 Rat tetrachloromethane increases expression ISO Arrdc2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of ARRDC2 mRNA CTD PMID:31919559 Arrdc2 Rat tetraphene affects expression ISO Arrdc2 (Mus musculus) 6480464 benz(a)anthracene affects the expression of ARRDC2 mRNA CTD PMID:26377693 Arrdc2 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of ARRDC2 mRNA CTD PMID:34492290 Arrdc2 Rat titanium dioxide increases expression ISO Arrdc2 (Mus musculus) 6480464 titanium dioxide results in increased expression of ARRDC2 mRNA CTD PMID:27760801 Arrdc2 Rat titanium dioxide decreases methylation ISO Arrdc2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ARRDC2 gene CTD PMID:35295148 Arrdc2 Rat triphenyl phosphate affects expression ISO ARRDC2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ARRDC2 mRNA CTD PMID:37042841 Arrdc2 Rat triptonide increases expression ISO Arrdc2 (Mus musculus) 6480464 triptonide results in increased expression of ARRDC2 mRNA CTD PMID:33045310 Arrdc2 Rat troglitazone decreases expression ISO Arrdc2 (Mus musculus) 6480464 troglitazone results in decreased expression of ARRDC2 mRNA CTD PMID:28973697 Arrdc2 Rat urethane increases expression ISO ARRDC2 (Homo sapiens) 6480464 Urethane results in increased expression of ARRDC2 mRNA CTD PMID:28818685 Arrdc2 Rat valproic acid decreases expression ISO ARRDC2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ARRDC2 mRNA CTD PMID:29154799 Arrdc2 Rat valproic acid increases methylation ISO ARRDC2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ARRDC2 gene CTD PMID:29154799 Arrdc2 Rat zinc atom multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of ARRDC2 mRNA CTD PMID:18593933 Arrdc2 Rat zinc(0) multiple interactions ISO ARRDC2 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of ARRDC2 mRNA CTD PMID:18593933
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsenous acid (ISO) azathioprine (ISO) benzene (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) carmustine (ISO) chloroprene (ISO) choline (ISO) cisplatin (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (ISO) diethyl maleate (EXP) dorsomorphin (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (ISO) folic acid (ISO) gentamycin (EXP) glyphosate (ISO) hydrogen sulfide (ISO) indometacin (ISO) isoprenaline (ISO) L-methionine (ISO) lead(0) (ISO) menadione (ISO) mercury dibromide (ISO) methamphetamine (ISO) methyl methanesulfonate (ISO) N-nitrosodiethylamine (EXP) niclosamide (ISO) orphenadrine (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) propiconazole (ISO) quercetin (ISO) SB 431542 (ISO) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) tetrachloromethane (EXP,ISO) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Arrdc2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 18,635,883 - 18,640,019 (+) NCBI GRCr8 mRatBN7.2 16 18,601,897 - 18,606,029 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 18,601,897 - 18,606,029 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 18,644,079 - 18,648,207 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 19,776,755 - 19,780,883 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 18,697,019 - 18,701,147 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 20,352,480 - 20,356,612 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 20,352,480 - 20,356,612 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 20,209,578 - 20,213,710 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 19,108,344 - 19,112,480 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 19,108,559 - 19,113,938 (+) NCBI Celera 16 18,793,987 - 18,798,119 (+) NCBI Celera Cytogenetic Map 16 p14 NCBI
ARRDC2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 18,001,124 - 18,014,102 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 18,001,132 - 18,014,102 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 18,111,933 - 18,124,911 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 17,972,944 - 17,985,911 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 17,979,976 - 17,985,909 NCBI Celera 19 18,013,652 - 18,026,620 (+) NCBI Celera Cytogenetic Map 19 p13.11 NCBI HuRef 19 17,677,133 - 17,689,735 (+) NCBI HuRef CHM1_1 19 18,111,582 - 18,124,534 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 18,135,202 - 18,148,181 (+) NCBI T2T-CHM13v2.0
Arrdc2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 71,287,773 - 71,293,173 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 71,287,773 - 71,292,364 (-) Ensembl GRCm39 Ensembl GRCm38 8 70,835,129 - 70,839,720 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 70,835,129 - 70,839,720 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 73,359,037 - 73,363,619 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 73,764,127 - 73,768,709 (-) NCBI MGSCv36 mm8 Celera 8 73,396,434 - 73,401,016 (-) NCBI Celera Cytogenetic Map 8 B3.3 NCBI cM Map 8 34.26 NCBI
ARRDC2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 22,859,991 - 22,873,192 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 21,870,572 - 21,881,551 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 17,480,879 - 17,491,851 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 18,461,626 - 18,469,085 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 18,461,626 - 18,469,079 (+) Ensembl panpan1.1 panPan2
ARRDC2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 44,931,066 - 44,937,711 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 44,904,789 - 44,938,257 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 44,844,135 - 44,850,691 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 45,416,414 - 45,422,969 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 45,416,473 - 45,422,969 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 44,653,466 - 44,660,011 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 45,063,809 - 45,070,363 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 45,339,755 - 45,346,310 (-) NCBI UU_Cfam_GSD_1.0
Arrdc2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 203,550,151 - 203,554,372 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936596 3,099,287 - 3,103,643 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936596 3,099,290 - 3,104,206 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ARRDC2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 59,771,113 - 59,778,354 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 59,771,104 - 59,778,500 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 59,339,832 - 59,347,208 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARRDC2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 16,472,643 - 16,484,642 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 16,472,907 - 16,484,637 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666074 2,894,743 - 2,906,949 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Arrdc2
.
Predicted Target Of
Count of predictions: 207 Count of miRNA genes: 144 Interacting mature miRNAs: 170 Transcripts: ENSRNOT00000025956 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 1582235 Insul8 Insulin level QTL 8 3.3 0.0063 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 16 1 26727669 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 631517 Scl9 Serum cholesterol level QTL 9 3.3 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 16 15726433 21034895 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 631830 Alc7 Alcohol consumption QTL 7 2.9 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 1 26727669 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 1600369 Hcas8 Hepatocarcinoma susceptibility QTL 8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 16 1 22477621 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 1300133 Rf24 Renal function QTL 24 3.64 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 16 3380150 21361552 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 634355 Rends4 Renal damage susceptibility QTL 4 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 16 1 26727669 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
RH139405
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 18,605,864 - 18,605,992 (+) MAPPER mRatBN7.2 Rnor_6.0 16 20,356,448 - 20,356,575 NCBI Rnor6.0 Rnor_5.0 16 20,213,546 - 20,213,673 UniSTS Rnor5.0 RGSC_v3.4 16 19,112,316 - 19,112,443 UniSTS RGSC3.4 Celera 16 18,797,955 - 18,798,082 UniSTS RH 3.4 Map 16 192.2 UniSTS Cytogenetic Map 16 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025956 ⟹ ENSRNOP00000025956
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 18,601,897 - 18,606,029 (+) Ensembl Rnor_6.0 Ensembl 16 20,352,480 - 20,356,612 (+) Ensembl
RefSeq Acc Id:
NM_001107303 ⟹ NP_001100773
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,635,883 - 18,640,015 (+) NCBI mRatBN7.2 16 18,601,897 - 18,606,029 (+) NCBI Rnor_6.0 16 20,352,480 - 20,356,612 (+) NCBI Rnor_5.0 16 20,209,578 - 20,213,710 (+) NCBI RGSC_v3.4 16 19,108,344 - 19,112,480 (+) RGD Celera 16 18,793,987 - 18,798,119 (+) RGD
Sequence:
GGGTCTTTTCCTGAAGGTGTGGCTTTCTCCTCAGGCCATCCCTTCGCCGCACTATTGGCCTAGTCTTTTCTGTGGGACTCAGCATTCTCCCTCTGGCCCCGCCCCTACTGTCCTGTTTACAGAGTCTC
hide sequence
RefSeq Acc Id:
XM_063275374 ⟹ XP_063131444
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,636,062 - 18,640,019 (+) NCBI
RefSeq Acc Id:
NP_001100773 ⟸ NM_001107303
- UniProtKB:
D3ZPW1 (UniProtKB/TrEMBL)
- Sequence:
MLFDKVKAFVVELDGTRAGTEPVFHGGQAVAGRVLLELAGAARVGALRLRARGRARAHWTESRSAGSSTAYTQSYSERVEVVNHRATLLAPDSGDIVMLPAGRHEFPFSFQLPISLVTSFEGKHGSVR
hide sequence
Ensembl Acc Id:
ENSRNOP00000025956 ⟸ ENSRNOT00000025956
RefSeq Acc Id:
XP_063131444 ⟸ XM_063275374
- Peptide Label:
isoform X1
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Arrdc2
arrestin domain containing 2
Arrdc2_predicted
arrestin domain containing 2 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Arrdc2_predicted
arrestin domain containing 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
