Advanced Search (OLGA)

Gene: Clba1 (clathrin binding box of aftiphilin containing 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Clba1

Name:

clathrin binding box of aftiphilin containing 1

RGD ID:

1307315

Description:

Predicted to enable clathrin binding activity. Predicted to be involved in intracellular transport. Predicted to be part of AP-1 adaptor complex. Predicted to be active in trans-Golgi network membrane. Orthologous to human CLBA1 (clathrin binding box of aftiphilin containing 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

clathrin binding box of aftiphilin containing; clathrin-binding box of aftiphilin-containing protein 1; hypothetical protein LOC362793; LOC362793; MGC105548; RGD1307315; uncharacterized protein C14orf79 homolog; uncharacterized protein CLBA1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	137,703,947 - 137,710,743 (+)	NCBI		GRCr8
mRatBN7.2	6	131,882,866 - 131,889,662 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	131,882,609 - 131,889,662 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	132,052,761 - 132,059,557 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	132,342,975 - 132,349,889 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	131,717,251 - 131,724,151 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	137,386,694 - 137,393,490 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	137,386,422 - 137,393,506 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	146,389,788 - 146,396,584 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	137,809,373 - 137,816,169 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	137,815,559 - 137,822,355 (+)	NCBI
Celera	6	129,422,066 - 129,428,862 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Clba1	Rat	Charcot-Marie-Tooth disease axonal type 2O		ISO	CLBA1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth disease axonal type 2O	ClinVar	PMID:28492532
Clba1	Rat	focal segmental glomerulosclerosis 5		ISO	CLBA1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Focal segmental glomerulosclerosis 5	ClinVar	PMID:28492532
Clba1	Rat	immunodeficiency 132A		ISO	CLBA1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Herpes simplex encephalitis more ...	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Clba1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	multiple interactions	ISO	Clba1 (Mus musculus)	6480464	[Flame Retardants results in increased abundance of 2 more ...	CTD	PMID:38995820
Clba1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	CLBA1 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin affects the expression of CLBA1 mRNA	CTD	PMID:22298810
Clba1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of CLBA1 mRNA	CTD	PMID:32109520 and PMID:33387578
Clba1	Rat	2,3,7,8-Tetrachlorodibenzofuran	increases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Clba1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	CLBA1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of CLBA1 mRNA	CTD	PMID:28628672
Clba1	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	CLBA1 (Homo sapiens)	6480464	bisphenol S results in increased methylation of CLBA1 gene	CTD	PMID:31601247
Clba1	Rat	acrylamide	decreases expression	ISO	CLBA1 (Homo sapiens)	6480464	Acrylamide results in decreased expression of CLBA1 mRNA	CTD	PMID:32763439
Clba1	Rat	aflatoxin B1	increases expression	ISO	CLBA1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of CLBA1 mRNA	CTD	PMID:21641981 and PMID:22100608
Clba1	Rat	all-trans-retinoic acid	decreases expression	ISO	CLBA1 (Homo sapiens)	6480464	Tretinoin results in decreased expression of CLBA1 mRNA	CTD	PMID:33167477
Clba1	Rat	aristolochic acid A	increases expression	ISO	CLBA1 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of CLBA1 mRNA	CTD	PMID:33212167
Clba1	Rat	arsane	multiple interactions	ISO	CLBA1 (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CLBA1 mRNA	CTD	PMID:32525701
Clba1	Rat	arsenic atom	multiple interactions	ISO	CLBA1 (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CLBA1 mRNA	CTD	PMID:32525701
Clba1	Rat	atrazine	decreases expression	ISO	CLBA1 (Homo sapiens)	6480464	Atrazine results in decreased expression of CLBA1 mRNA	CTD	PMID:22378314
Clba1	Rat	benzo[a]pyrene	decreases expression	ISO	CLBA1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of CLBA1 mRNA	CTD	PMID:22316170
Clba1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CLBA1 mRNA	CTD	PMID:25181051 more ...
Clba1	Rat	bisphenol A	increases expression	ISO	Clba1 (Mus musculus)	6480464	bisphenol A results in increased expression of CLBA1 mRNA	CTD	PMID:32156529
Clba1	Rat	bisphenol F	multiple interactions	ISO	CLBA1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of CLBA1 mRNA	CTD	PMID:28628672
Clba1	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of CLBA1 mRNA	CTD	PMID:33453195
Clba1	Rat	dexamethasone	multiple interactions	ISO	CLBA1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of CLBA1 mRNA	CTD	PMID:28628672
Clba1	Rat	Dibutyl phosphate	affects expression	ISO	CLBA1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of CLBA1 mRNA	CTD	PMID:37042841
Clba1	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of CLBA1 mRNA	CTD	PMID:21266533
Clba1	Rat	genistein	increases expression	ISO	Clba1 (Mus musculus)	6480464	Genistein results in increased expression of CLBA1 mRNA	CTD	PMID:32186404
Clba1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of CLBA1 mRNA	CTD	PMID:33387578
Clba1	Rat	indometacin	multiple interactions	ISO	CLBA1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of CLBA1 mRNA	CTD	PMID:28628672
Clba1	Rat	iron dichloride	decreases expression	ISO	CLBA1 (Homo sapiens)	6480464	ferrous chloride results in decreased expression of CLBA1 mRNA	CTD	PMID:35984750
Clba1	Rat	methyl methanesulfonate	increases expression	ISO	CLBA1 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of CLBA1 mRNA	CTD	PMID:23649840
Clba1	Rat	ozone	multiple interactions	ISO	Clba1 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of CLBA1 mRNA	CTD	PMID:34911549
Clba1	Rat	paracetamol	decreases expression	ISO	CLBA1 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of CLBA1 mRNA	CTD	PMID:26690555
Clba1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of CLBA1 mRNA	CTD	PMID:33387578
Clba1	Rat	rotenone	decreases expression	ISO	CLBA1 (Homo sapiens)	6480464	Rotenone results in decreased expression of CLBA1 mRNA	CTD	PMID:29955902
Clba1	Rat	sodium arsenate	multiple interactions	ISO	CLBA1 (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CLBA1 mRNA	CTD	PMID:32525701
Clba1	Rat	sodium arsenite	decreases expression	ISO	CLBA1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of CLBA1 mRNA	CTD	PMID:25879800 and PMID:38568856
Clba1	Rat	sodium arsenite	decreases expression	ISO	Clba1 (Mus musculus)	6480464	sodium arsenite results in decreased expression of CLBA1 mRNA	CTD	PMID:37682722
Clba1	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of CLBA1 mRNA	CTD	PMID:31150632
Clba1	Rat	thiram	decreases expression	ISO	CLBA1 (Homo sapiens)	6480464	Thiram results in decreased expression of CLBA1 mRNA	CTD	PMID:38568856
Clba1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of CLBA1 mRNA	CTD	PMID:33387578
Clba1	Rat	urethane	decreases expression	ISO	CLBA1 (Homo sapiens)	6480464	Urethane results in decreased expression of CLBA1 mRNA	CTD	PMID:28818685
Clba1	Rat	valproic acid	increases methylation	ISO	CLBA1 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of CLBA1 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Clba1	Rat	intracellular transport	involved_in	IEA	InterPro:IPR046359	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Clba1	Rat	intracellular transport	involved_in	IBA	FB:FBgn0038223 and PANTHER:PTN001043950	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Clba1	Rat	AP-1 adaptor complex	part_of	IBA	PANTHER:PTN001043950 and UniProtKB:Q6ULP2	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Clba1	Rat	trans-Golgi network membrane	is_active_in	IBA	FB:FBgn0038223 and PANTHER:PTN001043950	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Clba1	Rat	trans-Golgi network membrane	located_in	IEA	InterPro:IPR046359	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Clba1	Rat	clathrin binding	enables	IBA	PANTHER:PTN001043950 and UniProtKB:Q6ULP2	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Clba1	Rat	clathrin binding	enables	IEA	InterPro:IPR046359	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:15489334

Clba1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	137,703,947 - 137,710,743 (+)	NCBI		GRCr8
mRatBN7.2	6	131,882,866 - 131,889,662 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	131,882,609 - 131,889,662 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	132,052,761 - 132,059,557 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	132,342,975 - 132,349,889 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	131,717,251 - 131,724,151 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	137,386,694 - 137,393,490 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	137,386,422 - 137,393,506 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	146,389,788 - 146,396,584 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	137,809,373 - 137,816,169 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	137,815,559 - 137,822,355 (+)	NCBI
Celera	6	129,422,066 - 129,428,862 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

CLBA1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	104,985,788 - 105,001,274 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	104,985,775 - 105,010,482 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	105,452,125 - 105,461,853 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	104,523,661 - 104,532,900 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	104,526,537 - 104,532,900	NCBI
Celera	14	85,506,829 - 85,516,068 (+)	NCBI		Celera
Cytogenetic Map	14	q32.33	NCBI
HuRef	14	85,646,461 - 85,655,693 (+)	NCBI		HuRef
CHM1_1	14	105,390,377 - 105,399,616 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	99,230,266 - 99,245,748 (+)	NCBI		T2T-CHM13v2.0

Clba1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	112,772,595 - 112,779,865 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	112,772,557 - 112,779,872 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	112,808,975 - 112,816,245 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	112,808,937 - 112,816,252 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	114,047,186 - 114,054,456 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	113,256,783 - 113,264,053 (+)	NCBI		MGSCv36	mm8
Celera	12	114,017,579 - 114,024,842 (+)	NCBI		Celera
Cytogenetic Map	12	F1	NCBI
cM Map	12	61.2	NCBI

Clba1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955538	3,333,957 - 3,341,256 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955538	3,325,052 - 3,340,534 (+)	NCBI	ChiLan1.0	ChiLan1.0

CLBA1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	106,167,242 - 106,188,879 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	105,386,674 - 105,397,168 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	85,634,349 - 85,649,411 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	105,419,840 - 105,429,263 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	105,419,834 - 105,441,870 (+)	Ensembl	panpan1.1		panPan2

CLBA1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	72,448,580 - 72,454,685 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	72,443,323 - 72,454,191 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	71,959,132 - 71,967,232 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	72,734,778 - 72,742,877 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	72,736,027 - 72,742,877 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	72,417,326 - 72,423,576 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	72,461,885 - 72,468,127 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	72,855,875 - 72,863,973 (+)	NCBI		UU_Cfam_GSD_1.0

Clba1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	1,636,052 - 1,643,623 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936621	464,507 - 472,642 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936621	464,993 - 472,608 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CLBA1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa10.2	7	131,256,197 - 131,260,838 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CLBA1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	82,905,148 - 82,918,368 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	82,905,218 - 82,916,861 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	70,337,315 - 70,350,265 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Clba1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	394,627 - 401,296 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	394,718 - 401,828 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Clba1
28 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	67
Count of miRNA genes:	58
Interacting mature miRNAs:	63
Transcripts:	ENSRNOT00000018568
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat
4145118	Mcs26	Mammary carcinoma susceptibility QTL 26		0.0001	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	106752656	132339866	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	122549046	137801795	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	105156861	140994061	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	100364669	140994061	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	122549046	140994061	Rat
737976	Pia24	Pristane induced arthritis QTL 24			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	6	112636280	140994061	Rat
2312560	Pur20	Proteinuria QTL 20	2.1	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	125628133	137801795	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	100671796	132340886	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
8552796	Vie3	Viral induced encephalitis QTL 3	2.6		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	6	96833997	140994061	Rat
1300076	Glom8	Glomerulus QTL 8	7	9e-09	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat
2293085	Iddm29	Insulin dependent diabetes mellitus QTL 29	7.66		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	122549046	140286318	Rat

RH130051

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	131,889,444 - 131,889,627 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	137,393,273 - 137,393,455	NCBI	Rnor6.0
Rnor_5.0	6	146,396,367 - 146,396,549	UniSTS	Rnor5.0
RGSC_v3.4	6	137,815,952 - 137,816,134	UniSTS	RGSC3.4
Celera	6	129,428,645 - 129,428,827	UniSTS
RH 3.4 Map	6	782.4	UniSTS
Cytogenetic Map	6	q32	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001008377	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC086564	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018568 ⟹ ENSRNOP00000018568

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	131,882,609 - 131,889,662 (+)	Ensembl
Rnor_6.0 Ensembl	6	137,386,422 - 137,393,506 (+)	Ensembl

RefSeq Acc Id:

NM_001008377 ⟹ NP_001008378

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	137,703,947 - 137,710,743 (+)	NCBI
mRatBN7.2	6	131,882,866 - 131,889,662 (+)	NCBI
Rnor_6.0	6	137,386,694 - 137,393,490 (+)	NCBI
Rnor_5.0	6	146,389,788 - 146,396,584 (+)	NCBI
RGSC_v3.4	6	137,809,373 - 137,816,169 (+)	RGD
Celera	6	129,422,066 - 129,428,862 (+)	RGD

Sequence:

show sequence

CTGGTCCCCCTCGCGTGCCAGGCGGGGTCGACTCCACAGAGGCACGTGAACGCTCCCAGGAAGCCCTGGGCAACTCCAGCTCAGCAGCTGCATGTTTTCTGAGCAGCTTTCCTTCGGGTCGGCTGGCC
TGGCCACACCAAGATGCAAGGCGGGCGGGAGGTGGGGAGAGAGTCAGTGAGTGACCTCGCAGAGGAACTTGGAGAGGGGTCCCTCCACCCGACAGCCGGAGGACAGAGTGGTGATAGTTTGGAACGGA
GGAGGATCGGCTACGACGGTCCCGTGATTCTGCCGGACGCCAATGCTAACAGCTCCAGGCTGGATGAGGGTCTTTCCTCCAGCCGTCCACACCCAGGGGAGCTCGGCGGCGGGTGGGGAGAGTTCGAA
GGCTTCCAAGAGTCTTCAGCTAAGTCTGAGGAGTTTTCTCAGTCTTTTGAACTCCTGGGAAGGGCCGCGGAATGTCAGCCGCTGAGAACCCCTTCCACACCTAAAGAGGGCGGTTCTTGCCAGGTGCA
GCAGGGTGGACCCTGGGTGACAGGAACTGCTGCTGGCCCGTCTTCAGAGTCCATTCTCAGCTACGAGAAGGTTTTCAGGCTTGCGTTTCAAGAAGTCCCGGTGGAACAGGCAACCGAAGACGTTTGTT
CTTTGGACCGTTTCTTAGAAACAGGCAGCGAAGAAACTGCACCTGTGCCTAGACTGTGTTCCGAATCTAGGAAACTCTGGAGAGCCCTTCAGAACACCGACACCGTGTCTGCATCGAGGTGTCTCTGG
AGTGAATCTCACTGCCGGGAAAACCTCTTTCCTGTCCTTGGCATAGATGCTGCTCAGAAGAGCCTTTCTGGAGACCAGGGTCATGATCTGGAAGGTTCTGACTGCAGAAAGCCTGAAGATCTGCTGGG
AGTCAGTGGTTTCCACCTACACCACTGCAAAGCCCTGATTCAGACCAAGCTCTCAGGGACATCGGGCAGCAGACAGGGCAGCCTGATTACCTACAGTCTGTTTCTGAAGACACCACTCCAAGGGAATG
GGCGCTACATCACCATCCCACAGAAGAAGATCTTTACTCCACGCAACCTGAAAATGGCATTCTTTAATAACAACGTCTGCTAAAGGCCGGAGTGCTTTGTACCTTTATGAGACATTTTACATTTTCTT
ACTGGTTTGCTTGGGTACTAGAACTTGAGAATTCTGTGGCACTGTTTCCCAGGGCCGTGTTAGTTTCCTAGGACCTGTCAAACACATGCACTCAGATCTGATAGGGTGCACAGAAGGAATGTCTTTGT
GCAGAGCCAGCCCCCATGGAATTTCCGGGGACACCGTAGGCTGGCACCAGGTGCCTGTTGACCCCTACCTGCAGGCTCACAGTTGGACCCATGAGTTTCAGAAGTCAGAAGGTAGCTACTGATCACTG
GCAGGAACATGCCCTGCGCCTCCTGCCCCCACCCCTGTGCTGTTTCCTGGGGAGTTAACCTGTCTCTGTGTTAGATCCTGCCATCAACAGCCTCAGGGACAAGCTTTACTCTGAGTAGGAGGGTGGGA
AGGAGAACACACTGGGTGTCCTGGGAAGACAGCTGGATGAGCTTCCTTGGTCACCTGCTGAAACGGGTTCTACTCCAGGGGCATACACAAGCAGGCTGCACTACATTTTGTAAATTTTTATTAAAAAG
AAAGGACCGTAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001008378	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86564	(Get FASTA)	NCBI Sequence Viewer
	EDL97416	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018568
	ENSRNOP00000018568.3
GenBank Protein	Q5RJN9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001008378 ⟸ NM_001008377

- UniProtKB:

Q5RJN9 (UniProtKB/Swiss-Prot), A6KBW5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MQGGREVGRESVSDLAEELGEGSLHPTAGGQSGDSLERRRIGYDGPVILPDANANSSRLDEGLSSSRPHPGELGGGWGEFEGFQESSAKSEEFSQSFELLGRAAECQPLRTPSTPKEGGSCQVQQGGP
WVTGTAAGPSSESILSYEKVFRLAFQEVPVEQATEDVCSLDRFLETGSEETAPVPRLCSESRKLWRALQNTDTVSASRCLWSESHCRENLFPVLGIDAAQKSLSGDQGHDLEGSDCRKPEDLLGVSGF
HLHHCKALIQTKLSGTSGSRQGSLITYSLFLKTPLQGNGRYITIPQKKIFTPRNLKMAFFNNNVC

hide sequence

Ensembl Acc Id:

ENSRNOP00000018568 ⟸ ENSRNOT00000018568

Protein Domains

Aftiphilin clathrin-binding box

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5RJN9-F1-model_v2	AlphaFold	Q5RJN9	1-321	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13694855

Promoter ID:

EPDNEW_R5378

Type:

multiple initiation site

Name:

Clba1_1

Description:

clathrin binding box of aftiphilin containing 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	137,386,388 - 137,386,448	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-35774	BioCyc
Ensembl Genes	ENSRNOG00000013690	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018568	ENTREZGENE
	ENSRNOT00000018568.6	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7305233	IMAGE-MGC_LOAD
InterPro	Aftin-like	UniProtKB/Swiss-Prot
	Clathrin-bd	UniProtKB/Swiss-Prot
KEGG Report	rno:362793	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105548	IMAGE-MGC_LOAD
NCBI Gene	362793	ENTREZGENE
PANTHER	CLATHRIN_BDG DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot
	PTHR16156	UniProtKB/Swiss-Prot
Pfam	Clathrin_bdg	UniProtKB/Swiss-Prot
PhenoGen	Clba1	PhenoGen
RatGTEx	ENSRNOG00000013690	RatGTEx
UniProt	A6KBW5	ENTREZGENE, UniProtKB/TrEMBL
	CLBA1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-07-31	Clba1	clathrin binding box of aftiphilin containing 1	Clba1	clathrin binding box of aftiphilin containing	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2017-07-18	Clba1	clathrin binding box of aftiphilin containing	RGD1307315	LOC362793	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1307315	LOC362793	RGD1307315_predicted	LOC362793 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1307315_predicted	LOC362793 (predicted)	LOC362793_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC362793_predicted	LOC362793 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar