Advanced Search (OLGA)

Gene: Urm1 (ubiquitin related modifier 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Urm1

Name:

ubiquitin related modifier 1

RGD ID:

1306599

Description:

Predicted to enable sulfur carrier activity. Predicted to be involved in tRNA thio-modification and tRNA wobble uridine modification. Orthologous to human URM1 (ubiquitin related modifier 1); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; bisphenol A; decabromodiphenyl ether.

Type:

protein-coding (Ensembl: lncRNA)

RefSeq Status:

VALIDATED

Previously known as:

LOC311840; RGD1306599; similar to RIKEN cDNA 2900073H19; ubiquitin related modifier 1 homolog; ubiquitin related modifier 1 homolog (S. cerevisiae); ubiquitin-related modifier 1; ubiquitin-related modifier 1 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	URM1 (ubiquitin related modifier 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Urm1 (ubiquitin related modifier 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Urm1 (ubiquitin related modifier 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	URM1 (ubiquitin related modifier 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	URM1 (ubiquitin related modifier 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Urm1 (ubiquitin related modifier 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	URM1 (ubiquitin related modifier 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	URM1 (ubiquitin related modifier 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Urm1 (ubiquitin related modifier 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	URM1 (ubiquitin related modifier 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Urm1 (ubiquitin related modifier 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	urm1 (ubiquitin related modifier 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Urm1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	URM1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	urm-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	33,489,974 - 33,514,942 (+)	NCBI		GRCr8
mRatBN7.2	3	13,100,340 - 13,117,064 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	13,092,200 - 13,117,642 (+)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	3	13,100,343 - 13,117,048 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	16,175,118 - 16,191,842 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	24,760,080 - 24,776,803 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	23,011,338 - 23,028,089 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	8,389,024 - 8,405,868 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	8,389,024 - 8,405,868 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	13,732,444 - 13,749,414 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	8,815,032 - 8,829,512 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	8,815,349 - 8,832,632 (+)	NCBI
Celera	3	7,877,776 - 7,894,483 (+)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Urm1	Rat	developmental and epileptic encephalopathy		ISO	URM1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy	ClinVar	PMID:18469812 more ...
Urm1	Rat	developmental and epileptic encephalopathy 31A		ISO	URM1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Epileptic encephalopathy more ...	ClinVar	PMID:18469812 more ...
Urm1	Rat	dystonia		ISO	URM1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dystonic disorder	ClinVar	PMID:28492532
Urm1	Rat	early infantile epileptic encephalopathy		ISO	URM1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Early infantile epileptic encephalopathy	ClinVar	PMID:18469812 more ...
Urm1	Rat	primary coenzyme Q10 deficiency 7		ISO	URM1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neonatal encephalomyopathy-cardiomyopathy-respiratory distress syndrome	ClinVar	PMID:22368301 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Urm1	Rat	Disease Progression		ISO	URM1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21364753
Urm1	Rat	Stomach Neoplasms		ISO	URM1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21364753

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Urm1	Rat	1,2-dimethylhydrazine	increases expression	ISO	Urm1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of URM1 mRNA	CTD	PMID:22206623
Urm1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	EXP		6480464	2 more ...	CTD	PMID:27291303
Urm1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Urm1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of URM1 mRNA	CTD	PMID:21570461
Urm1	Rat	aflatoxin B1	increases expression	ISO	Urm1 (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of URM1 mRNA	CTD	PMID:19770486
Urm1	Rat	all-trans-retinoic acid	decreases expression	ISO	URM1 (Homo sapiens)	6480464	Tretinoin results in decreased expression of URM1 mRNA	CTD	PMID:33167477
Urm1	Rat	Aroclor 1254	increases expression	ISO	Urm1 (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in increased expression of URM1 mRNA	CTD	PMID:23650126
Urm1	Rat	atrazine	decreases expression	ISO	URM1 (Homo sapiens)	6480464	Atrazine results in decreased expression of URM1 mRNA	CTD	PMID:22378314
Urm1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Urm1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of URM1 mRNA	CTD	PMID:34319233
Urm1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of URM1 mRNA	CTD	PMID:25181051
Urm1	Rat	bisphenol A	increases expression	ISO	Urm1 (Mus musculus)	6480464	bisphenol A results in increased expression of URM1 mRNA	CTD	PMID:32156529
Urm1	Rat	cadmium dichloride	increases expression	ISO	URM1 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of URM1 mRNA	CTD	PMID:26472689
Urm1	Rat	cadmium dichloride	decreases expression	ISO	URM1 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of URM1 mRNA	CTD	PMID:38568856
Urm1	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of URM1 mRNA	CTD	PMID:23640034
Urm1	Rat	fenofibrate	decreases expression	ISO	Urm1 (Mus musculus)	6480464	Fenofibrate results in decreased expression of URM1 mRNA	CTD	PMID:21318169
Urm1	Rat	fenofibrate	multiple interactions	ISO	Urm1 (Mus musculus)	6480464	PPARA protein affects the reaction [Fenofibrate results in decreased expression of URM1 mRNA]	CTD	PMID:21318169
Urm1	Rat	fipronil	decreases expression	EXP		6480464	fipronil results in decreased expression of URM1 mRNA	CTD	PMID:34044035
Urm1	Rat	folic acid	increases expression	ISO	Urm1 (Mus musculus)	6480464	Folic Acid results in increased expression of URM1 mRNA	CTD	PMID:25629700
Urm1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of URM1 mRNA	CTD	PMID:33387578
Urm1	Rat	ivermectin	decreases expression	ISO	URM1 (Homo sapiens)	6480464	Ivermectin results in decreased expression of URM1 protein	CTD	PMID:32959892
Urm1	Rat	paracetamol	decreases expression	ISO	Urm1 (Mus musculus)	6480464	Acetaminophen results in decreased expression of URM1 mRNA	CTD	PMID:17585979
Urm1	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	URM1 (Homo sapiens)	6480464	perfluorohexanesulfonic acid results in decreased expression of URM1 mRNA	CTD	PMID:25812627
Urm1	Rat	perfluorononanoic acid	decreases expression	ISO	URM1 (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in decreased expression of URM1 mRNA	CTD	PMID:25812627
Urm1	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	URM1 (Homo sapiens)	6480464	perfluorooctane sulfonic acid results in decreased expression of URM1 mRNA	CTD	PMID:25812627
Urm1	Rat	perfluorooctanoic acid	decreases expression	ISO	URM1 (Homo sapiens)	6480464	perfluorooctanoic acid results in decreased expression of URM1 mRNA	CTD	PMID:25812627
Urm1	Rat	pirinixic acid	increases expression	ISO	Urm1 (Mus musculus)	6480464	pirinixic acid results in increased expression of URM1 mRNA	CTD	PMID:21318169
Urm1	Rat	pirinixic acid	multiple interactions	ISO	Urm1 (Mus musculus)	6480464	PPARA protein affects the reaction [pirinixic acid results in increased expression of URM1 mRNA]	CTD	PMID:21318169
Urm1	Rat	sodium arsenite	decreases expression	ISO	URM1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of URM1 mRNA	CTD	PMID:38568856
Urm1	Rat	sunitinib	decreases expression	ISO	URM1 (Homo sapiens)	6480464	Sunitinib results in decreased expression of URM1 mRNA	CTD	PMID:31533062
Urm1	Rat	tetrachloromethane	affects expression	ISO	Urm1 (Mus musculus)	6480464	Carbon Tetrachloride affects the expression of URM1 mRNA	CTD	PMID:17484886
Urm1	Rat	titanium dioxide	decreases methylation	ISO	Urm1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of URM1 gene	CTD	PMID:35295148
Urm1	Rat	triptonide	increases expression	ISO	Urm1 (Mus musculus)	6480464	triptonide results in increased expression of URM1 mRNA	CTD	PMID:33045310
Urm1	Rat	trovafloxacin	increases expression	ISO	Urm1 (Mus musculus)	6480464	trovafloxacin results in increased expression of URM1 mRNA	CTD	PMID:35537566
Urm1	Rat	valproic acid	increases expression	ISO	URM1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of URM1 mRNA	CTD	PMID:23179753
Urm1	Rat	vinclozolin	increases methylation	EXP		6480464	vinclozolin results in increased methylation of URM1 gene	CTD	PMID:31079544

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Urm1	Rat	tRNA thio-modification	involved_in	ISO	URM1 (Homo sapiens)	1624291	PMID:19017811	RGD	PMID:19017811
Urm1	Rat	tRNA wobble uridine modification	involved_in	ISO	URM1 (Homo sapiens)	1624291	PMID:19017811	RGD	PMID:19017811

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Urm1	Rat	protein binding	enables	ISO	URM1 (Homo sapiens)	1624291	UniProtKB:O95396 more ...	RGD	PMID:19017811 and PMID:21209336
Urm1	Rat	sulfur carrier activity	enables	ISO	URM1 (Homo sapiens)	1624291	PMID:19017811	RGD	PMID:19017811

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:19017811	PMID:23376485

Urm1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	33,489,974 - 33,514,942 (+)	NCBI		GRCr8
mRatBN7.2	3	13,100,340 - 13,117,064 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	13,092,200 - 13,117,642 (+)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	3	13,100,343 - 13,117,048 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	16,175,118 - 16,191,842 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	24,760,080 - 24,776,803 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	23,011,338 - 23,028,089 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	8,389,024 - 8,405,868 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	8,389,024 - 8,405,868 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	13,732,444 - 13,749,414 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	8,815,032 - 8,829,512 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	8,815,349 - 8,832,632 (+)	NCBI
Celera	3	7,877,776 - 7,894,483 (+)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

URM1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	128,371,319 - 128,392,016 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	128,371,361 - 128,392,016 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	131,133,598 - 131,154,295 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	130,173,461 - 130,192,834 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	128,213,193 - 128,232,566	NCBI
Celera	9	101,784,501 - 101,803,918 (+)	NCBI		Celera
Cytogenetic Map	9	q34.11	NCBI
HuRef	9	100,746,421 - 100,767,118 (+)	NCBI		HuRef
CHM1_1	9	131,284,635 - 131,305,320 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	140,578,420 - 140,599,118 (+)	NCBI		T2T-CHM13v2.0

Urm1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	29,717,401 - 29,735,008 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	29,710,087 - 29,735,014 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	29,827,389 - 29,844,996 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	29,820,075 - 29,845,002 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	29,682,909 - 29,700,516 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	29,649,398 - 29,667,005 (+)	NCBI		MGSCv36	mm8
Celera	2	29,534,482 - 29,552,090 (+)	NCBI		Celera
Cytogenetic Map	2	B	NCBI
cM Map	2	20.67	NCBI

Urm1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955570	876,487 - 894,045 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955570	876,487 - 894,045 (+)	NCBI	ChiLan1.0	ChiLan1.0

URM1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	10,961,349 - 10,983,159 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	10,963,698 - 10,984,319 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	99,492,453 - 99,513,046 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	128,160,921 - 128,181,976 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	128,160,984 - 128,179,700 (+)	Ensembl	panpan1.1		panPan2

URM1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	55,141,050 - 55,157,176 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	55,141,801 - 55,157,066 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	54,336,026 - 54,352,084 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	56,063,152 - 56,079,212 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	56,061,935 - 56,079,188 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	54,822,745 - 54,838,806 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	55,137,011 - 55,153,063 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	55,228,902 - 55,244,958 (-)	NCBI		UU_Cfam_GSD_1.0

Urm1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	196,145,451 - 196,163,419 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936487	15,914,119 - 15,933,083 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936487	15,914,087 - 15,933,114 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

URM1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	268,798,462 - 268,815,530 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	268,798,439 - 268,815,553 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	302,788,192 - 302,805,447 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

URM1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	9,741,181 - 9,762,033 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666079	6,477,641 - 6,498,618 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Urm1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	6,503,882 - 6,520,671 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	6,503,882 - 6,520,807 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Urm1
114 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	136
Count of miRNA genes:	106
Interacting mature miRNAs:	127
Transcripts:	ENSRNOT00000037494
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	22677150	50766390	Rat
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	29056275	47904329	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
10450811	Scl73	Serum cholesterol level QTL 73	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
2292615	Ept17	Estrogen-induced pituitary tumorigenesis QTL 17	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6556347	51556347	Rat
10450808	Scl72	Serum cholesterol level QTL 72	4.4	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
10450806	Scl71	Serum cholesterol level QTL 71	5.8	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	28625339	67641995	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	6125437	51125437	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	36721849	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	6556347	51556347	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	3e-08	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	22677150	50766390	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	15272348	60272348	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	29056275	47904329	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358185	Ept6	Estrogen-induced pituitary tumorigenesis QTL 6	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6556347	51556347	Rat

AA942949

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	13,116,862 - 13,117,003 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	8,405,667 - 8,405,807	NCBI	Rnor6.0
Rnor_5.0	3	13,749,213 - 13,749,353	UniSTS	Rnor5.0
RGSC_v3.4	3	8,832,142 - 8,832,282	UniSTS	RGSC3.4
Celera	3	7,894,282 - 7,894,422	UniSTS
RH 3.4 Map	3	51.41	UniSTS
Cytogenetic Map	3	p12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001137562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283934	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC114363	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC169094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BP465324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB313752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000037494 ⟹ ENSRNOP00000032608

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	13,100,347 - 13,117,049 (+)	Ensembl
Rnor_6.0 Ensembl	3	8,389,024 - 8,405,868 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095401

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	13,115,268 - 13,117,642 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096115

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	13,100,343 - 13,117,048 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106388

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	13,092,200 - 13,117,642 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107675

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	13,100,309 - 13,117,642 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114356

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	13,104,396 - 13,117,174 (+)	Ensembl

RefSeq Acc Id:

NM_001137562 ⟹ NP_001131034

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	33,498,219 - 33,514,942 (+)	NCBI
mRatBN7.2	3	13,100,340 - 13,117,064 (+)	NCBI
Rnor_6.0	3	8,389,024 - 8,405,868 (+)	NCBI
Rnor_5.0	3	13,732,444 - 13,749,414 (+)	NCBI
RGSC_v3.4	3	8,815,032 - 8,829,512 (+)	RGD
Celera	3	7,877,776 - 7,894,483 (+)	NCBI

Sequence:

show sequence

GCTAGTTTGGCTTCCTCAACATGGCGGCGCCCTTATGTGTGGAGGTGGAGTTCGGAGGTGGTGCGGAGCTCCTGTTTGATGGGGTAAAAAAGCATCAAGTCACCTTGCCTGGGCAGGAGGAACCCTGG
GATATCCGGAACCTCCTTGTCTGGATCAAGACGAATTTGCTAAAAGAGCGGCCAGAGCTATTCATCCAGGGAGACAGTGTGCGGCCTGGAATCCTGGTCCTGATTAATGATGCCGACTGGGAACTGCT
GGGAGAGCTGGACTACCAGCTGCAGGACCAGGATAGCATCCTCTTCATCTCCACCCTGCATGGCGGCTGAGGCCTCCTCGATTAGCCCAAGCACCTTTGCAAGGGGAACACAGGACAACCACAGACCC
CTCGGATGCTTCCAGGTCCTCCGTCCCCCTTGGCTGCCTCCTTCCCTGCTGTACCCCTGAGCTTCCTGTATGCAGGGAAAAGAGGCCAGGTGCTAAAAATGAGCCTTTCTGGGCAAGGCGGCACGTGA
GCAGGGAGAGAGAGCAGGGAGGGAGAGCAGCCGCCTGAGCCCAGCACTCCTTCCAGCAGCTGAGGTGGGGGAGGGTGCTCCTGTGCTGTGTCAGGAGTGGAGGGGCTCTGTGCCCAGGTGACCCAGCT
GCTTGCTGCTACGTCTTGGTGTATGTATGCTCTTAGTGGTGGCCTGGAAGGCACTCCAGTTCCCGAGACATCTTCATGGGGAAGATGGATGGACTGTAGTAACTGATGAGAGGCTCCTCCCTTGCCAA
AGATTAGAGGGGCCTCCGCCTCAGTTTCCCCATCTGGACACAGAGAGCTCTGCTTGTCCCCCACTGATGTCATTATGGAACCCCAGCTGGGGTCCCCTATTCAGTGCTCACCTCCCTCCCCTCCACTC
AGCAGCTGCTCTCCTAGCTATACCCCTCCTCCCGTTCCCCCATCCCCAGCCCTTGACCCTGGCTGGCCTCCCCCCCCCCCCCCCCCACATAGGCCACCAGATGGGCTCCTGAGACACTCTCCAGGCTG
CCTACAACTCATTCTGTTGGGGGTAGAAAATGGAAGGAAGTAGCCTAACTTTAGGCAGAGGGGGGCGGGCCTCAGCATGTGTAACTCCAGGCTTCCTGAAACAAGCAGGATTTGGGTGTCCCCCCTTT
CCTCCATCCCTTCTGGAACTCTGGAGACTTCATGCCTGCAACAGCTGGCCTTGGGCAAATAAAGAGACTAGGTTGTTTACTAGCCTTGCCTCA

hide sequence

RefSeq Acc Id:

XM_063283934 ⟹ XP_063140004

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	33,489,974 - 33,514,931 (+)	NCBI


Protein RefSeqs	NP_001131034	(Get FASTA)	NCBI Sequence Viewer
	XP_063140004	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI69094	(Get FASTA)	NCBI Sequence Viewer
	EDL93371	(Get FASTA)	NCBI Sequence Viewer
	EDL93372	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000100702

RefSeq Acc Id:	NP_001131034 ⟸ NM_001137562
- UniProtKB:	B6ID11 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAPLCVEVEFGGGAELLFDGVKKHQVTLPGQEEPWDIRNLLVWIKTNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG hide sequence

Ensembl Acc Id:

ENSRNOP00000032608 ⟸ ENSRNOT00000037494

RefSeq Acc Id:	XP_063140004 ⟸ XM_063283934
- Peptide Label:	isoform X1

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B6ID11-F1-model_v2	AlphaFold	B6ID11	1-101	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13691944

Promoter ID:

EPDNEW_R2469

Type:

multiple initiation site

Name:

Urm1_1

Description:

ubiquitin related modifier 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	8,389,038 - 8,389,098	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-50252	BioCyc
Ensembl Genes	ENSRNOG00000026636	Ensembl, ENTREZGENE
	ENSRNOG00000064341	Ensembl
Ensembl Transcript	ENSRNOT00000037494	ENTREZGENE
Gene3D-CATH	3.10.20.30	UniProtKB/TrEMBL
InterPro	b-grasp_ferredoxin-like	UniProtKB/TrEMBL
	Mopterin_synth/thiamin_S_b	UniProtKB/TrEMBL
	Urm1	UniProtKB/TrEMBL
KEGG Report	rno:311840	UniProtKB/TrEMBL
NCBI Gene	311840	ENTREZGENE
PANTHER	PTHR14986	UniProtKB/TrEMBL
Pfam	Urm1	UniProtKB/TrEMBL
PhenoGen	Urm1	PhenoGen
PIRSF	Ubiquitin-related_modifier_1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000026636	RatGTEx
	ENSRNOG00000064341	RatGTEx
RNAcentral	URS00022AF1CD	RNACentral
	URS00022AF7B7	RNACentral
	URS00022B1EDC	RNACentral
	URS00022B23C6	RNACentral
	URS00022B509F	RNACentral
	URS00022B5C6C	RNACentral
Superfamily-SCOP	Mo_synth/thiamin_syn_S_b-grasp	UniProtKB/TrEMBL
UniProt	B6ID11	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-01	Urm1	ubiquitin related modifier 1	Urm1	ubiquitin related modifier 1 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Urm1	ubiquitin related modifier 1 homolog (S. cerevisiae)	RGD1306599_predicted	similar to RIKEN cDNA 2900073H19 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1306599_predicted	similar to RIKEN cDNA 2900073H19 (predicted)	LOC311840_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC311840_predicted	similar to RIKEN cDNA 2900073H19 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD