Advanced Search (OLGA)

Gene: Rpl3l (ribosomal protein L3-like) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Rpl3l

Name:

ribosomal protein L3-like

RGD ID:

1306315

Description:

Predicted to enable RNA binding activity. Predicted to be a structural constituent of ribosome. Predicted to be involved in negative regulation of myotube differentiation; regulation of striated muscle tissue development; and translation. Predicted to be part of cytosolic large ribosomal subunit. Human ortholog(s) of this gene implicated in dilated cardiomyopathy 2D. Orthologous to human RPL3L (ribosomal protein L3 like); INTERACTS WITH 6-propyl-2-thiouracil; alpha-Zearalanol; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

60S ribosomal protein L3-like; LOC287122; ribosomal protein uL3-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPL3L (ribosomal protein L3 like)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Rpl3l (ribosomal protein L3-like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rpl3l (ribosomal protein L3 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPL3L (ribosomal protein L3 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPL3L (ribosomal protein L3 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rpl3l (ribosomal protein L3 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPL3L (ribosomal protein L3 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPL3L (ribosomal protein L3 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rpl3l (ribosomal protein L3 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RPL3 (ribosomal protein L3)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	RPL3L (ribosomal protein L3 like)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rpl3l (ribosomal protein L3-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpl-3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPL3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpL3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rpl3l	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	14,258,446 - 14,268,989 (+)	NCBI		GRCr8
mRatBN7.2	10	13,753,914 - 13,764,458 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	13,753,886 - 13,764,457 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	18,500,711 - 18,511,038 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	17,989,571 - 17,999,898 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	13,488,767 - 13,499,098 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	14,094,769 - 14,105,312 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	14,094,754 - 14,105,308 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	13,910,497 - 13,921,040 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	13,981,948 - 13,992,491 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	13,981,939 - 14,092,927 (+)	NCBI
Celera	10	13,433,633 - 13,444,176 (+)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rpl3l	Rat	cardiomyopathy		ISO	RPL3L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cardiomyopathy	ClinVar	PMID:25741868 more ...
Rpl3l	Rat	developmental and epileptic encephalopathy 1		ISO	RPL3L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy and 1	ClinVar	PMID:28492532 and PMID:30866059
Rpl3l	Rat	dilated cardiomyopathy 2D		ISO	RPL3L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cardiomyopathy more ...	ClinVar	PMID:25741868 more ...
Rpl3l	Rat	epilepsy		ISO	RPL3L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Epilepsy	ClinVar	PMID:28492532
Rpl3l	Rat	Idiopathic Generalized Epilepsy		ISO	RPL3L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Idiopathic generalized epilepsy	ClinVar	PMID:28492532
Rpl3l	Rat	short-rib thoracic dysplasia 9 with or without polydactyly		ISO	RPL3L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Saldino-Mainzer syndrome	ClinVar	PMID:28492532
Rpl3l	Rat	tuberous sclerosis 2		ISO	RPL3L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Tuberous sclerosis 2	ClinVar	PMID:10205261 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rpl3l	Rat	atrial fibrillation		ISO	RPL3L (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:30061737
Rpl3l	Rat	Neoplasm Invasiveness		ISO	RPL3L (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:26213588

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rpl3l	Rat	dilated cardiomyopathy 2D		ISO	RPL3L (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rpl3l	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	Rpl3l (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in decreased expression of RPL3L mRNA	CTD	PMID:18648102
Rpl3l	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	Rpl3l (Mus musculus)	6480464	bisphenol S results in decreased methylation of RPL3L exon	CTD	PMID:33297965
Rpl3l	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Rpl3l (Mus musculus)	6480464	bisphenol S affects the methylation of RPL3L gene	CTD	PMID:31683443
Rpl3l	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of RPL3L mRNA	CTD	PMID:24780913
Rpl3l	Rat	all-trans-retinoic acid	increases expression	ISO	Rpl3l (Mus musculus)	6480464	Tretinoin results in increased expression of RPL3L mRNA	CTD	PMID:36189433
Rpl3l	Rat	all-trans-retinoic acid	multiple interactions	ISO	Rpl3l (Mus musculus)	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of RPL3L mRNA	CTD	PMID:36189433
Rpl3l	Rat	alpha-Zearalanol	decreases expression	EXP		6480464	Zeranol results in decreased expression of RPL3L mRNA	CTD	PMID:35163327
Rpl3l	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of RPL3L mRNA	CTD	PMID:35163327
Rpl3l	Rat	asbestos	increases expression	ISO	RPL3L (Homo sapiens)	6480464	Asbestos results in increased expression of RPL3L mRNA	CTD	PMID:22398240
Rpl3l	Rat	benzo[a]pyrene	decreases expression	ISO	Rpl3l (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of RPL3L mRNA	CTD	PMID:22228805
Rpl3l	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of RPL3L mRNA	CTD	PMID:27178563
Rpl3l	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of RPL3L mRNA	CTD	PMID:25181051 and PMID:32145629
Rpl3l	Rat	cantharidin	decreases expression	ISO	Rpl3l (Mus musculus)	6480464	Cantharidin results in decreased expression of RPL3L mRNA	CTD	PMID:36907384
Rpl3l	Rat	chlorpyrifos	decreases expression	ISO	Rpl3l (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of RPL3L mRNA	CTD	PMID:32715474
Rpl3l	Rat	graphite	increases expression	ISO	Rpl3l (Mus musculus)	6480464	Graphite results in increased expression of RPL3L mRNA	CTD	PMID:27440207
Rpl3l	Rat	GW 4064	decreases expression	ISO	Rpl3l (Mus musculus)	6480464	GW 4064 results in decreased expression of RPL3L mRNA	CTD	PMID:26655953
Rpl3l	Rat	lead(0)	decreases expression	ISO	RPL3L (Homo sapiens)	6480464	Lead results in decreased expression of RPL3L mRNA	CTD	PMID:19921347
Rpl3l	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	Rpl3l (Mus musculus)	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of RPL3L mRNA	CTD	PMID:36189433
Rpl3l	Rat	oxaliplatin	decreases expression	EXP		6480464	oxaliplatin results in decreased expression of RPL3L mRNA	CTD	PMID:25729387
Rpl3l	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of RPL3L mRNA	CTD	PMID:25729387
Rpl3l	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of RPL3L mRNA	CTD	PMID:35163327
Rpl3l	Rat	perfluorooctanoic acid	increases expression	EXP		6480464	perfluorooctanoic acid results in increased expression of RPL3L mRNA	CTD	PMID:35163327
Rpl3l	Rat	pioglitazone	multiple interactions	ISO	Rpl3l (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of RPL3L mRNA	CTD	PMID:27935865
Rpl3l	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of RPL3L mRNA	CTD	PMID:25729387
Rpl3l	Rat	triazines	multiple interactions	ISO	Rpl3l (Mus musculus)	6480464	Triazines inhibits the reaction [IDH2 protein mutant form results in decreased expression of RPL3L mRNA]	CTD	PMID:27469509
Rpl3l	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of RPL3L mRNA	CTD	PMID:33387578
Rpl3l	Rat	triptonide	increases expression	ISO	Rpl3l (Mus musculus)	6480464	triptonide results in increased expression of RPL3L mRNA	CTD	PMID:33045310
Rpl3l	Rat	tris(2-butoxyethyl) phosphate	decreases expression	ISO	RPL3L (Homo sapiens)	6480464	tris(2-butoxyethyl) phosphate results in decreased expression of RPL3L mRNA	CTD	PMID:29024780
Rpl3l	Rat	trovafloxacin	increases expression	ISO	Rpl3l (Mus musculus)	6480464	trovafloxacin results in increased expression of RPL3L mRNA	CTD	PMID:35537566
Rpl3l	Rat	urethane	increases expression	ISO	RPL3L (Homo sapiens)	6480464	Urethane results in increased expression of RPL3L mRNA	CTD	PMID:28818685
Rpl3l	Rat	valproic acid	increases methylation	ISO	RPL3L (Homo sapiens)	6480464	Valproic Acid results in increased methylation of RPL3L gene	CTD	PMID:29154799
Rpl3l	Rat	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of RPL3L mRNA	CTD	PMID:35594946

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rpl3l	Rat	negative regulation of myotube differentiation	involved_in	ISO	Rpl3l (Mus musculus)	1624291	PMID:26684695	RGD	PMID:26684695
Rpl3l	Rat	negative regulation of myotube differentiation	involved_in	IEA	UniProtKB:E9PWZ3 and ensembl:ENSMUSP00000129325	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rpl3l	Rat	regulation of striated muscle tissue development	involved_in	ISO	Rpl3l (Mus musculus)	1624291	PMID:34081545	RGD	PMID:34081545
Rpl3l	Rat	regulation of striated muscle tissue development	involved_in	IEA	UniProtKB:E9PWZ3 and ensembl:ENSMUSP00000129325	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rpl3l	Rat	translation	involved_in	IEA	InterPro:IPR000597 and InterPro:IPR045077	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Rpl3l	Rat	translation	involved_in	IBA	PANTHER:PTN000146039 and SGD:S000005589	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rpl3l	Rat	cytosolic large ribosomal subunit	part_of	IBA	MGI:1351605 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rpl3l	Rat	cytosolic large ribosomal subunit	part_of	IEA	UniProtKB:E9PWZ3 and ensembl:ENSMUSP00000129325	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rpl3l	Rat	cytosolic large ribosomal subunit	part_of	ISO	Rpl3l (Mus musculus)	1624291	PMID:36517592	RGD	PMID:36517592
Rpl3l	Rat	ribonucleoprotein complex	part_of	IEA	UniProtKB-KW:KW-0687	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rpl3l	Rat	ribosome	located_in	IEA	ARBA:ARBA00029180	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Rpl3l	Rat	ribosome	located_in	IEA	InterPro:IPR000597 and InterPro:IPR045077	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Rpl3l	Rat	ribosome	located_in	IEA	UniProtKB-KW:KW-0689	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rpl3l	Rat	RNA binding	enables	IBA	PANTHER:PTN000146039 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rpl3l	Rat	structural constituent of ribosome	enables	ISO	Rpl3l (Mus musculus)	1624291	PMID:36517592	RGD	PMID:36517592
Rpl3l	Rat	structural constituent of ribosome	enables	IEA	UniProtKB:E9PWZ3 and ensembl:ENSMUSP00000129325	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rpl3l	Rat	structural constituent of ribosome	enables	IEA	InterPro:IPR000597 and InterPro:IPR045077	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Rpl3l	Rat	structural constituent of ribosome	enables	IBA	FB:FBgn0020910 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12962325	PMID:19946888

Rpl3l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	14,258,446 - 14,268,989 (+)	NCBI		GRCr8
mRatBN7.2	10	13,753,914 - 13,764,458 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	13,753,886 - 13,764,457 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	18,500,711 - 18,511,038 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	17,989,571 - 17,999,898 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	13,488,767 - 13,499,098 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	14,094,769 - 14,105,312 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	14,094,754 - 14,105,308 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	13,910,497 - 13,921,040 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	13,981,948 - 13,992,491 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	13,981,939 - 14,092,927 (+)	NCBI
Celera	10	13,433,633 - 13,444,176 (+)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

RPL3L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	1,943,974 - 1,954,689 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	1,943,974 - 1,957,606 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	1,993,975 - 2,004,690 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	1,934,581 - 1,944,680 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	1,934,581 - 1,944,680	NCBI
Celera	16	2,206,784 - 2,216,862 (-)	NCBI		Celera
Cytogenetic Map	16	p13.3	NCBI
HuRef	16	1,919,182 - 1,929,274 (-)	NCBI		HuRef
CHM1_1	16	1,994,524 - 2,004,626 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	1,963,946 - 1,975,094 (-)	NCBI		T2T-CHM13v2.0

Rpl3l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	24,946,800 - 24,955,117 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	24,946,794 - 24,955,117 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	24,727,826 - 24,736,143 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	24,727,820 - 24,736,143 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	24,864,774 - 24,873,094 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	24,460,285 - 24,463,745 (+)	NCBI		MGSCv36	mm8
Celera	17	25,250,910 - 25,259,506 (+)	NCBI		Celera
Cytogenetic Map	17	A3.3	NCBI
cM Map	17	12.52	NCBI

Rpl3l
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	15,313,729 - 15,322,578 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955442	15,311,336 - 15,322,578 (+)	NCBI	ChiLan1.0	ChiLan1.0

RPL3L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	2,392,806 - 2,402,560 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	6,174,718 - 6,185,119 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	749,186 - 760,331 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	2,033,466 - 2,043,719 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	2,033,466 - 2,043,719 (-)	Ensembl	panpan1.1		panPan2

RPL3L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	38,971,098 - 38,981,466 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	38,974,018 - 38,982,012 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	40,213,023 - 40,220,944 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	39,290,349 - 39,298,272 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	39,290,443 - 39,298,276 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	38,967,123 - 38,975,038 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	38,939,432 - 38,947,353 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	39,418,319 - 39,426,245 (+)	NCBI		UU_Cfam_GSD_1.0

Rpl3l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	104,623,130 - 104,630,679 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936694	2,078,903 - 2,086,354 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936694	2,078,903 - 2,086,333 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPL3L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	40,007,868 - 40,016,699 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	40,004,907 - 40,016,702 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

RPL3L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	1,841,959 - 1,853,944 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	1,842,604 - 1,853,444 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	29,225,541 - 29,234,560 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rpl3l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624913	301,938 - 310,469 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624913	301,921 - 310,655 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Rpl3l
28 total Variants

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
10	13918364	13918365	T	A	snv	LEC/Tj (KyushuU)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	58
Interacting mature miRNAs:	59
Transcripts:	ENSRNOT00000019660
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6661118	35509383	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5893811	50893811	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5893811	50893811	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6877142	51877142	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35730538	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	922197	45922197	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	2103708	47103708	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5893811	50893811	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	1	17749933	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38832698	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	11	45	97	85	83	53	25	53	6	196	93	77	34	55	30


RefSeq Transcripts	NM_001191589	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC115181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214717	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215051	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216207	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216295	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216388	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224678	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019660 ⟹ ENSRNOP00000019660

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	13,753,886 - 13,764,457 (+)	Ensembl
Rnor_6.0 Ensembl	10	14,094,754 - 14,105,308 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112206 ⟹ ENSRNOP00000089495

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	13,753,886 - 13,762,699 (+)	Ensembl

RefSeq Acc Id:

NM_001191589 ⟹ NP_001178518

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	14,258,446 - 14,268,989 (+)	NCBI
mRatBN7.2	10	13,753,914 - 13,764,458 (+)	NCBI
Rnor_6.0	10	14,094,769 - 14,105,312 (+)	NCBI
Rnor_5.0	10	13,910,497 - 13,921,040 (+)	NCBI
Celera	10	13,433,633 - 13,444,176 (+)	NCBI

Sequence:

show sequence

GTGGGGAGGTCCCTTCCTAACCTGCAGGGATCGTCCATGTCTCACCGGAAGTTCTCTGCTCCTCGACATGGACACCTGGGCTTCCTGCCCCACAAGAGGAGCCGGCGGCACCGGGGCAAGGTGAAGAG
CTGGCCTCGCGATGACCCCAGCCAGCCCGTGCACCTCACAGCCTTCTTGGGCTATAAGGCCGGCATGACCCACACACTTCGCGAAGTGCACCGACCTGGACTCAAAATTTCTAAGCGAGAGGAGGTAG
AAGCTGTGACAATTGTGGAGACGCCCCCACTGGTGGTGGTGGGCGTGGTGGGCTACGTGGCCACTCCGAGGGGGCTGCGGAGCTTCAAGACCATCTTTGCCGAACACCTCAGCGATGAGTGTCGCCGG
AGATTCTACAAGGACTGGCACAAGAGTAAGAAGAAAGCCTTTACCAAAGCCTGCAAGAGGTGGCGGGACGCCGATGGCAAGAAGCAGCTGCAGAAAGACTTTGCTGCCATGAAGAAATACTGCAAGGT
CATTCGGGTCATCGTCCACACCCAGATGAAGCTGCTGCCCTTTAGGCAGAAGAAGGCCCACATCATGGAGATTCAGCTGAATGGTGGCACTGTGGCTGAGAAGGTGGCCTGGGCTCAGGCACGGTTGG
AGAAGCAGGTGCCTGTACACAGTGTGTTCAGCCAGAGTGAGGTTATTGATGTCATTGCTGTCACGAAGGGCCGGGGTGTTAAAGGGGTCACCAGTCGCTGGCATACCAAGAAGCTTCCTAGGAAGACC
CACAAAGGCCTGCGCAAGGTGGCCTGTATTGGTGCCTGGCACCCTGCCCGAGTAGGCTGCTCCATCGCCCGGGCTGGGCAGAAGGGTTACCACCACCGTACAGAGCTGAACAAGAAGATCTACCGCAT
TGGCCGGGGGCTGCACATGGAAGACGGGAAGATGGTCAGAAACAACGCATCTACCAGCTATGACGTAACCGACAAGTCTATCACACCCCTGGGTGGCTTCCCCCACTACGGGGAAGTGAACAATGACT
TCGTCATGTTAAAAGGCTGCATTGCTGGCACCAAGAAGAGAGTGATCACACTGAGGAAGTCCCTACTAGTGCACCACAGCCGCAGGGCCCTGGAGAATATTGAGCTCAAGTTCATTGACACCACTTCT
AAGTTTGGCCACGGATGCTTCCAGACAGCGCAGGAGAAGAGGGCCTTCATGGGCCCCCAAAAGAAACATCTGGAGAAAGAGAAGCCGGAGACCTCGGGAAACGTCTAAGATGCCTGGAATGGAGCACA
CCTGGGATGGAGTGCTTCCTGTCCTTTTTGTTCAATAAAGTCCTGAGGAAACTCTA

hide sequence


Protein RefSeqs	NP_001178518	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019660
	ENSRNOP00000019660.5
	ENSRNOP00000089495.1

RefSeq Acc Id:

NP_001178518 ⟸ NM_001191589

- UniProtKB:

D4A9G1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSHRKFSAPRHGHLGFLPHKRSRRHRGKVKSWPRDDPSQPVHLTAFLGYKAGMTHTLREVHRPGLKISKREEVEAVTIVETPPLVVVGVVGYVATPRGLRSFKTIFAEHLSDECRRRFYKDWHKSKKK
AFTKACKRWRDADGKKQLQKDFAAMKKYCKVIRVIVHTQMKLLPFRQKKAHIMEIQLNGGTVAEKVAWAQARLEKQVPVHSVFSQSEVIDVIAVTKGRGVKGVTSRWHTKKLPRKTHKGLRKVACIGA
WHPARVGCSIARAGQKGYHHRTELNKKIYRIGRGLHMEDGKMVRNNASTSYDVTDKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRRALENIELKFIDTTSKFGHGCFQTAQE
KRAFMGPQKKHLEKEKPETSGNV

hide sequence

Ensembl Acc Id:

ENSRNOP00000019660 ⟸ ENSRNOT00000019660

Ensembl Acc Id:

ENSRNOP00000089495 ⟸ ENSRNOT00000112206

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A9G1-F1-model_v2	AlphaFold	D4A9G1	1-407	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13697026

Promoter ID:

EPDNEW_R7551

Type:

initiation region

Name:

Rpl3l_1

Description:

ribosomal protein L3-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	14,094,749 - 14,094,809	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-25825	BioCyc
Ensembl Genes	ENSRNOG00000014641	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019660	ENTREZGENE
	ENSRNOT00000019660.8	UniProtKB/TrEMBL
	ENSRNOT00000112206.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.1430.10	UniProtKB/TrEMBL
	4.10.960.10	UniProtKB/TrEMBL
	Translation factors	UniProtKB/TrEMBL
InterPro	L3_arc_euk	UniProtKB/TrEMBL
	Ribosomal_L3	UniProtKB/TrEMBL
	Ribosomal_L3_CS	UniProtKB/TrEMBL
	Ribosomal_L3_dom_3_arc_sf	UniProtKB/TrEMBL
	Transl_elong_init/rib_B-barrel	UniProtKB/TrEMBL
KEGG Report	rno:287122	UniProtKB/TrEMBL
NCBI Gene	287122	ENTREZGENE
PANTHER	60S RIBOSOMAL PROTEIN L3-LIKE	UniProtKB/TrEMBL
	PTHR11363	UniProtKB/TrEMBL
Pfam	Ribosomal_L3	UniProtKB/TrEMBL
PhenoGen	Rpl3l	PhenoGen
PROSITE	RIBOSOMAL_L3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000014641	RatGTEx
Superfamily-SCOP	Translat_factor	UniProtKB/TrEMBL
UniProt	A0A8I6GI57_RAT	UniProtKB/TrEMBL
	D4A9G1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Rpl3l	ribosomal protein L3-like	Rpl3l_predicted	ribosomal protein L3-like (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Rpl3l_predicted	ribosomal protein L3-like (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM