Symbol:
Ube2e2
Name:
ubiquitin-conjugating enzyme E2E 2
RGD ID:
1305644
Description:
Predicted to enable ISG15 transferase activity and ubiquitin conjugating enzyme activity. Predicted to be involved in protein modification by small protein conjugation. Predicted to act upstream of or within DNA damage response and positive regulation of G1/S transition of mitotic cell cycle. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in type 2 diabetes mellitus. Orthologous to human UBE2E2 (ubiquitin conjugating enzyme E2 E2); PARTICIPATES IN Endoplasmic Reticulum-associated degradation pathway; ubiquitin/proteasome degradation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC361013; ubiquitin-conjugating enzyme E2 E2; ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 9,411,067 - 9,688,731 (+) NCBI GRCr8 mRatBN7.2 15 6,980,241 - 7,257,912 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 6,980,474 - 7,257,532 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 9,117,264 - 9,395,237 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 10,030,041 - 10,308,015 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 8,330,495 - 8,608,451 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 7,402,210 - 7,928,320 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 7,871,497 - 7,927,939 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 11,469,650 - 11,995,676 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 8,554,863 - 8,828,088 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 8,554,863 - 8,827,742 (+) NCBI Celera 15 7,042,822 - 7,313,674 (+) NCBI Celera Cytogenetic Map 15 p16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ube2e2 Rat (1->4)-beta-D-glucan multiple interactions ISO Ube2e2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of UBE2E2 mRNA CTD PMID:36331819 Ube2e2 Rat 1,2-dimethylhydrazine decreases expression ISO Ube2e2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of UBE2E2 mRNA CTD PMID:22206623 Ube2e2 Rat 1,2-dimethylhydrazine multiple interactions ISO Ube2e2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of UBE2E2 mRNA CTD PMID:22206623 Ube2e2 Rat 17beta-estradiol decreases expression ISO UBE2E2 (Homo sapiens) 6480464 Estradiol results in decreased expression of UBE2E2 mRNA CTD PMID:21185374 Ube2e2 Rat 17beta-estradiol increases expression ISO Ube2e2 (Mus musculus) 6480464 Estradiol results in increased expression of UBE2E2 mRNA CTD PMID:39298647 Ube2e2 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Ube2e2 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Ube2e2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ube2e2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of UBE2E2 mRNA CTD PMID:16214954 Ube2e2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ube2e2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of UBE2E2 mRNA CTD PMID:18172886 more ... Ube2e2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ube2e2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of UBE2E2 mRNA CTD PMID:21570461 Ube2e2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of UBE2E2 mRNA] CTD PMID:21215274 Ube2e2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of UBE2E2 mRNA CTD PMID:21215274 and PMID:32109520 Ube2e2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Ube2e2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of UBE2E2 mRNA CTD PMID:21346803 Ube2e2 Rat 4,4'-sulfonyldiphenol increases expression ISO Ube2e2 (Mus musculus) 6480464 bisphenol S results in increased expression of UBE2E2 mRNA CTD PMID:39298647 Ube2e2 Rat aflatoxin B1 decreases expression ISO Ube2e2 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of UBE2E2 mRNA CTD PMID:19770486 Ube2e2 Rat aflatoxin B1 decreases methylation ISO UBE2E2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of UBE2E2 gene CTD PMID:27153756 Ube2e2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of UBE2E2 mRNA CTD PMID:30047161 Ube2e2 Rat aristolochic acid A decreases expression ISO UBE2E2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of UBE2E2 mRNA CTD PMID:33212167 Ube2e2 Rat arsane increases methylation ISO UBE2E2 (Homo sapiens) 6480464 Arsenic results in increased methylation of UBE2E2 promoter CTD PMID:21291286 Ube2e2 Rat arsane multiple interactions ISO UBE2E2 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of UBE2E2 mRNA CTD PMID:39836092 Ube2e2 Rat arsane affects methylation ISO UBE2E2 (Homo sapiens) 6480464 Arsenic affects the methylation of UBE2E2 gene CTD PMID:25304211 Ube2e2 Rat arsenic atom increases methylation ISO UBE2E2 (Homo sapiens) 6480464 Arsenic results in increased methylation of UBE2E2 promoter CTD PMID:21291286 Ube2e2 Rat arsenic atom multiple interactions ISO UBE2E2 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of UBE2E2 mRNA CTD PMID:39836092 Ube2e2 Rat arsenic atom affects methylation ISO UBE2E2 (Homo sapiens) 6480464 Arsenic affects the methylation of UBE2E2 gene CTD PMID:25304211 Ube2e2 Rat arsenite(3-) multiple interactions ISO UBE2E2 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to UBE2E2 mRNA] CTD PMID:32406909 Ube2e2 Rat atrazine increases expression ISO UBE2E2 (Homo sapiens) 6480464 Atrazine results in increased expression of UBE2E2 mRNA CTD PMID:22378314 Ube2e2 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of UBE2E2 gene CTD PMID:35440735 Ube2e2 Rat benzo[a]pyrene decreases expression ISO Ube2e2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of UBE2E2 mRNA CTD PMID:19770486 and PMID:21715664 Ube2e2 Rat benzo[a]pyrene decreases expression ISO UBE2E2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of UBE2E2 mRNA CTD PMID:20064835 more ... Ube2e2 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of UBE2E2 mRNA CTD PMID:21839799 Ube2e2 Rat beta-lapachone increases expression ISO UBE2E2 (Homo sapiens) 6480464 beta-lapachone results in increased expression of UBE2E2 mRNA CTD PMID:38218311 Ube2e2 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of UBE2E2 protein CTD PMID:27914986 Ube2e2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ube2e2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of UBE2E2 mRNA CTD PMID:34319233 Ube2e2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of UBE2E2 mRNA CTD PMID:25181051 Ube2e2 Rat bisphenol A increases expression ISO Ube2e2 (Mus musculus) 6480464 bisphenol A results in increased expression of UBE2E2 mRNA CTD PMID:32156529 Ube2e2 Rat bisphenol A decreases expression ISO Ube2e2 (Mus musculus) 6480464 bisphenol A results in decreased expression of UBE2E2 mRNA CTD PMID:33221593 Ube2e2 Rat cannabidiol increases expression ISO UBE2E2 (Homo sapiens) 6480464 Cannabidiol results in increased expression of UBE2E2 mRNA CTD PMID:28025562 Ube2e2 Rat choline multiple interactions ISO Ube2e2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of UBE2E2 gene CTD PMID:20938992 Ube2e2 Rat ciguatoxin CTX1B affects expression ISO Ube2e2 (Mus musculus) 6480464 Ciguatoxins affects the expression of UBE2E2 mRNA CTD PMID:18353800 Ube2e2 Rat cisplatin decreases expression ISO Ube2e2 (Mus musculus) 6480464 Cisplatin results in decreased expression of UBE2E2 mRNA CTD PMID:24280081 Ube2e2 Rat cisplatin decreases expression ISO UBE2E2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of UBE2E2 mRNA CTD PMID:19561079 and PMID:24280081 Ube2e2 Rat cyclosporin A increases expression ISO UBE2E2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of UBE2E2 mRNA CTD PMID:20106945 Ube2e2 Rat cyclosporin A decreases methylation ISO UBE2E2 (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of UBE2E2 promoter CTD PMID:27989131 Ube2e2 Rat cyclosporin A decreases expression ISO Ube2e2 (Mus musculus) 6480464 Cyclosporine results in decreased expression of UBE2E2 mRNA CTD PMID:19770486 Ube2e2 Rat dorsomorphin multiple interactions ISO UBE2E2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of UBE2E2 mRNA CTD PMID:27188386 Ube2e2 Rat doxorubicin decreases expression ISO UBE2E2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of UBE2E2 mRNA CTD PMID:29803840 Ube2e2 Rat entinostat increases expression ISO UBE2E2 (Homo sapiens) 6480464 entinostat results in increased expression of UBE2E2 mRNA CTD PMID:27188386 Ube2e2 Rat fenbendazole multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Fenbendazole] results in decreased expression of UBE2E2 protein CTD PMID:27914986 Ube2e2 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of UBE2E2 mRNA CTD PMID:23962444 Ube2e2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of UBE2E2 mRNA CTD PMID:24136188 Ube2e2 Rat folic acid multiple interactions ISO Ube2e2 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Ube2e2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of UBE2E2 mRNA CTD PMID:22061828 and PMID:33387578 Ube2e2 Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of UBE2E2 gene CTD PMID:35440735 Ube2e2 Rat graphite affects expression EXP 6480464 Graphite affects the expression of UBE2E2 mRNA CTD PMID:29933104 Ube2e2 Rat hydrogen peroxide affects expression ISO UBE2E2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of UBE2E2 mRNA CTD PMID:21179406 Ube2e2 Rat L-methionine multiple interactions ISO Ube2e2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of UBE2E2 gene CTD PMID:20938992 Ube2e2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of UBE2E2 mRNA CTD PMID:30047161 Ube2e2 Rat methylmercury chloride decreases expression ISO UBE2E2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of UBE2E2 mRNA CTD PMID:23179753 Ube2e2 Rat N-acetyl-1,4-benzoquinone imine affects response to substance ISO UBE2E2 (Homo sapiens) 6480464 UBE2E2 gene SNP affects the susceptibility to N-acetyl-4-benzoquinoneimine CTD PMID:21177773 Ube2e2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of UBE2E2 protein more ... CTD PMID:27914986 Ube2e2 Rat nickel sulfate decreases expression ISO UBE2E2 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of UBE2E2 mRNA CTD PMID:22714537 Ube2e2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of UBE2E2 mRNA CTD PMID:25729387 Ube2e2 Rat ozone multiple interactions ISO Ube2e2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of UBE2E2 mRNA CTD PMID:27106289 Ube2e2 Rat paracetamol affects expression ISO Ube2e2 (Mus musculus) 6480464 Acetaminophen affects the expression of UBE2E2 mRNA CTD PMID:17562736 Ube2e2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of UBE2E2 mRNA CTD PMID:33387578 Ube2e2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ube2e2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of UBE2E2 mRNA CTD PMID:36331819 Ube2e2 Rat phenobarbital multiple interactions ISO Ube2e2 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of UBE2E2 mRNA] CTD PMID:19482888 Ube2e2 Rat phenobarbital multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of UBE2E2 protein CTD PMID:27914986 Ube2e2 Rat phenobarbital increases expression ISO Ube2e2 (Mus musculus) 6480464 Phenobarbital results in increased expression of UBE2E2 mRNA CTD PMID:19482888 Ube2e2 Rat piperonyl butoxide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Piperonyl Butoxide] results in decreased expression of UBE2E2 protein CTD PMID:27914986 Ube2e2 Rat pirinixic acid multiple interactions ISO Ube2e2 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in increased expression of UBE2E2 mRNA] CTD PMID:21318169 Ube2e2 Rat pirinixic acid increases expression ISO Ube2e2 (Mus musculus) 6480464 pirinixic acid results in increased expression of UBE2E2 mRNA CTD PMID:18301758 more ... Ube2e2 Rat quercetin increases expression ISO UBE2E2 (Homo sapiens) 6480464 Quercetin results in increased expression of UBE2E2 mRNA CTD PMID:21632981 Ube2e2 Rat rotenone decreases expression ISO Ube2e2 (Mus musculus) 6480464 Rotenone results in decreased expression of UBE2E2 mRNA CTD PMID:23186747 Ube2e2 Rat SB 431542 multiple interactions ISO UBE2E2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of UBE2E2 mRNA CTD PMID:27188386 Ube2e2 Rat sodium arsenite affects methylation ISO UBE2E2 (Homo sapiens) 6480464 sodium arsenite affects the methylation of UBE2E2 gene CTD PMID:28589171 Ube2e2 Rat sodium arsenite multiple interactions ISO UBE2E2 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of UBE2E2 mRNA CTD PMID:39836092 Ube2e2 Rat sodium dodecyl sulfate decreases expression ISO UBE2E2 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in decreased expression of UBE2E2 mRNA CTD PMID:31734321 Ube2e2 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of UBE2E2 mRNA CTD PMID:30047161 Ube2e2 Rat sunitinib increases expression ISO UBE2E2 (Homo sapiens) 6480464 Sunitinib results in increased expression of UBE2E2 mRNA CTD PMID:31533062 Ube2e2 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of UBE2E2 protein CTD PMID:27914986 Ube2e2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of UBE2E2 mRNA CTD PMID:27914986 and PMID:34492290 Ube2e2 Rat thioacetamide increases methylation EXP 6480464 Thioacetamide results in increased methylation of UBE2E2 promoter CTD PMID:27914986 Ube2e2 Rat titanium dioxide decreases methylation ISO Ube2e2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of UBE2E2 promoter CTD PMID:35295148 Ube2e2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of UBE2E2 mRNA CTD PMID:25729387 Ube2e2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of UBE2E2 mRNA CTD PMID:33387578 Ube2e2 Rat trichostatin A decreases expression ISO UBE2E2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of UBE2E2 mRNA CTD PMID:26272509 Ube2e2 Rat trichostatin A multiple interactions ISO UBE2E2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of UBE2E2 mRNA CTD PMID:27188386 Ube2e2 Rat valproic acid affects expression ISO UBE2E2 (Homo sapiens) 6480464 Valproic Acid affects the expression of UBE2E2 mRNA CTD PMID:25979313 Ube2e2 Rat valproic acid increases expression ISO UBE2E2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of UBE2E2 mRNA CTD PMID:23179753 and PMID:27188386 Ube2e2 Rat zinc dichloride increases expression ISO UBE2E2 (Homo sapiens) 6480464 zinc chloride results in increased expression of UBE2E2 mRNA CTD PMID:18947441
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) amitrole (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (EXP,ISO) benzo[a]pyrene (EXP,ISO) beta-lapachone (ISO) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cannabidiol (ISO) choline (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) cyclosporin A (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) fenbendazole (EXP) fipronil (EXP) flutamide (EXP) folic acid (ISO) gentamycin (EXP) glyphosate (EXP) graphite (EXP) hydrogen peroxide (ISO) L-methionine (ISO) methimazole (EXP) methylmercury chloride (ISO) N-acetyl-1,4-benzoquinone imine (ISO) N-nitrosodiethylamine (EXP) nickel sulfate (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (EXP,ISO) piperonyl butoxide (EXP) pirinixic acid (ISO) quercetin (ISO) rotenone (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) sulfadimethoxine (EXP) sunitinib (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) trichostatin A (ISO) valproic acid (ISO) zinc dichloride (ISO)
Ube2e2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 9,411,067 - 9,688,731 (+) NCBI GRCr8 mRatBN7.2 15 6,980,241 - 7,257,912 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 6,980,474 - 7,257,532 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 9,117,264 - 9,395,237 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 10,030,041 - 10,308,015 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 8,330,495 - 8,608,451 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 7,402,210 - 7,928,320 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 7,871,497 - 7,927,939 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 11,469,650 - 11,995,676 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 8,554,863 - 8,828,088 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 8,554,863 - 8,827,742 (+) NCBI Celera 15 7,042,822 - 7,313,674 (+) NCBI Celera Cytogenetic Map 15 p16 NCBI
UBE2E2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 23,203,098 - 23,591,925 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 23,203,020 - 23,591,794 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 23,244,589 - 23,633,416 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 23,219,812 - 23,607,074 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 23,219,811 - 23,607,074 NCBI Celera 3 23,181,176 - 23,568,475 (+) NCBI Celera Cytogenetic Map 3 p24.3 NCBI HuRef 3 23,195,983 - 23,578,212 (+) NCBI HuRef CHM1_1 3 23,196,572 - 23,584,124 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 23,208,135 - 23,596,988 (+) NCBI T2T-CHM13v2.0
Ube2e2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 3,575,429 - 3,896,133 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 3,575,429 - 3,896,121 (+) Ensembl GRCm39 Ensembl GRCm38 14 18,573,563 - 18,894,284 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 18,573,575 - 18,894,267 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 19,406,091 - 19,726,141 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 17,366,703 - 17,686,753 (-) NCBI MGSCv36 mm8 Celera 14 14,258,953 - 14,589,761 (-) NCBI Celera Cytogenetic Map 14 A1 NCBI cM Map 14 7.08 NCBI
Ube2e2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955430 15,122,377 - 15,441,523 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955430 15,122,373 - 15,442,264 (+) NCBI ChiLan1.0 ChiLan1.0
UBE2E2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 23,164,902 - 23,550,662 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 23,169,694 - 23,555,428 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 23,121,699 - 23,502,329 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 23,440,772 - 23,826,027 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 23,446,158 - 23,825,277 (+) Ensembl panpan1.1 panPan2
UBE2E2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 20,110,128 - 20,593,767 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 20,130,230 - 20,486,399 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 20,126,888 - 20,601,866 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 20,441,820 - 20,915,867 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 20,442,596 - 20,811,888 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 20,250,902 - 20,782,556 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 20,360,456 - 20,837,497 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 20,469,605 - 20,997,864 (-) NCBI UU_Cfam_GSD_1.0
Ube2e2
UBE2E2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 9,998,199 - 10,380,556 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 9,998,097 - 10,380,564 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 11,329,305 - 11,329,480 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC103241760
.
Predicted Target Of
Count of predictions: 291 Count of miRNA genes: 191 Interacting mature miRNAs: 213 Transcripts: ENSRNOT00000046879 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641913 Colcr2 Colorectal carcinoma resistance QTL 2 6.57 0.0197 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 15 2266368 22711984 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 5684946 Bss98 Bone structure and strength QTL 98 3.9 0.0026 tibia strength trait (VT:1000284) tibia ultimate force (CMO:0001734) 15 1058250 14481294 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat
D15Got11
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 15 9,612,921 - 9,613,202 (+) Marker Load Pipeline mRatBN7.2 15 7,182,101 - 7,182,382 (+) MAPPER mRatBN7.2 Rnor_6.0 15 7,852,893 - 7,853,173 NCBI Rnor6.0 Rnor_5.0 15 11,920,249 - 11,920,529 UniSTS Rnor5.0 RGSC_v3.4 15 8,752,426 - 8,752,707 RGD RGSC3.4 RGSC_v3.4 15 8,752,427 - 8,752,707 UniSTS RGSC3.4 RGSC_v3.1 15 8,752,427 - 8,752,707 RGD Celera 15 7,238,079 - 7,238,359 UniSTS RH 3.4 Map 15 95.3 RGD RH 3.4 Map 15 95.3 UniSTS RH 2.0 Map 15 50.7 RGD Cytogenetic Map 15 p16 UniSTS
D15Mco16
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 15 8,687,763 - 8,687,912 (+) Marker Load Pipeline mRatBN7.2 15 6,256,908 - 6,257,057 (+) MAPPER mRatBN7.2 Rnor_6.0 15 7,430,229 - 7,430,377 NCBI Rnor6.0 Rnor_5.0 15 11,497,180 - 11,497,328 UniSTS Rnor5.0 RGSC_v3.4 15 7,804,369 - 7,804,518 RGD RGSC3.4 RGSC_v3.4 15 7,804,370 - 7,804,518 UniSTS RGSC3.4 RGSC_v3.1 15 7,804,369 - 7,804,518 RGD Celera 15 6,329,629 - 6,329,777 UniSTS Cytogenetic Map 15 p16 UniSTS
D3S3993
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 7,257,660 - 7,257,908 (+) MAPPER mRatBN7.2 Rnor_6.0 15 7,928,068 - 7,928,315 NCBI Rnor6.0 Rnor_5.0 15 11,995,424 - 11,995,671 UniSTS Rnor5.0 RGSC_v3.4 15 8,828,217 - 8,828,464 UniSTS RGSC3.4 Celera 15 7,313,803 - 7,314,050 UniSTS Cytogenetic Map 15 p16 UniSTS
RH129032
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 7,493,152 - 7,493,356 (+) MAPPER mRatBN7.2 Rnor_6.0 15 8,177,996 - 8,178,199 NCBI Rnor6.0 Rnor_5.0 15 12,240,037 - 12,240,240 UniSTS Rnor5.0 RGSC_v3.4 15 9,071,441 - 9,071,644 UniSTS RGSC3.4 Celera 15 7,546,445 - 7,546,648 UniSTS RH 3.4 Map 15 72.2 UniSTS Cytogenetic Map 15 p16 UniSTS
D4Mit282
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 15 11,884,198 - 11,884,360 NCBI Rnor5.0 Rnor_5.0 15 11,884,216 - 11,884,360 NCBI Rnor5.0 RGSC_v3.4 15 8,716,278 - 8,716,439 UniSTS RGSC3.4 RGSC_v3.4 15 8,716,296 - 8,716,439 UniSTS RGSC3.4 Celera 15 7,202,590 - 7,202,733 UniSTS Celera 15 7,202,572 - 7,202,733 UniSTS Cytogenetic Map 15 p16 UniSTS
AW532084
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 7,132,041 - 7,132,236 (+) MAPPER mRatBN7.2 Rnor_6.0 15 7,802,900 - 7,803,094 NCBI Rnor6.0 Rnor_5.0 15 11,870,256 - 11,870,450 UniSTS Rnor5.0 RGSC_v3.4 15 8,702,335 - 8,702,529 UniSTS RGSC3.4 Celera 15 7,188,629 - 7,188,823 UniSTS RH 3.4 Map 15 93.3 UniSTS Cytogenetic Map 15 p16 UniSTS
BE120096
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 7,452,809 - 7,452,989 (+) MAPPER mRatBN7.2 Rnor_6.0 15 8,137,940 - 8,138,119 NCBI Rnor6.0 Rnor_5.0 15 12,200,843 - 12,201,022 UniSTS Rnor5.0 RGSC_v3.4 15 9,029,607 - 9,029,786 UniSTS RGSC3.4 Celera 15 7,508,068 - 7,508,247 UniSTS RH 3.4 Map 15 73.3 UniSTS Cytogenetic Map 15 p16 UniSTS
RH141730
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 7,437,329 - 7,437,543 (+) MAPPER mRatBN7.2 Rnor_6.0 15 8,122,464 - 8,122,677 NCBI Rnor6.0 Rnor_5.0 15 12,185,520 - 12,185,733 UniSTS Rnor5.0 RGSC_v3.4 15 9,014,055 - 9,014,268 UniSTS RGSC3.4 Celera 15 7,492,894 - 7,493,107 UniSTS RH 3.4 Map 15 91.7 UniSTS Cytogenetic Map 15 p16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000046879 ⟹ ENSRNOP00000049082
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 6,986,277 - 7,257,532 (+) Ensembl Rnor_6.0 Ensembl 15 7,871,497 - 7,927,939 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105543 ⟹ ENSRNOP00000087029
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 6,980,474 - 7,257,532 (+) Ensembl
RefSeq Acc Id:
NM_001108371 ⟹ NP_001101841
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 9,411,620 - 9,688,731 (+) NCBI mRatBN7.2 15 6,980,794 - 7,257,912 (+) NCBI Rnor_6.0 15 7,402,247 - 7,927,939 (+) NCBI Rnor_5.0 15 11,469,650 - 11,995,676 (+) NCBI RGSC_v3.4 15 8,554,863 - 8,828,088 (+) RGD Celera 15 7,042,822 - 7,313,674 (+) RGD
Sequence:
CCCAGGATCTAAGATGTCCACCGAGGCACAGAGAGTTGATGACAGTCCAAGCACTAGCGGAGGAAGTTCTGATGGCGATCAACGGGAGAGTGTTCAGCAGGAACCTGAGCGGGAGCAAGTTCAGCCCA
hide sequence
RefSeq Acc Id:
NM_001399659 ⟹ NP_001386588
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 9,411,067 - 9,688,731 (+) NCBI mRatBN7.2 15 6,980,241 - 7,257,912 (+) NCBI
RefSeq Acc Id:
NM_001399660 ⟹ NP_001386589
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 9,411,067 - 9,688,731 (+) NCBI mRatBN7.2 15 6,980,241 - 7,257,912 (+) NCBI
RefSeq Acc Id:
NM_001399661 ⟹ NP_001386590
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 9,411,620 - 9,688,731 (+) NCBI mRatBN7.2 15 6,980,794 - 7,257,912 (+) NCBI
RefSeq Acc Id:
NP_001101841 ⟸ NM_001108371
- Peptide Label:
isoform 1
- UniProtKB:
D3ZYE1 (UniProtKB/TrEMBL), A6K030 (UniProtKB/TrEMBL)
- Sequence:
MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKD
hide sequence
Ensembl Acc Id:
ENSRNOP00000049082 ⟸ ENSRNOT00000046879
Ensembl Acc Id:
ENSRNOP00000087029 ⟸ ENSRNOT00000105543
RefSeq Acc Id:
NP_001386589 ⟸ NM_001399660
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I6A2G8 (UniProtKB/TrEMBL), A6K029 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386588 ⟸ NM_001399659
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I6A2G8 (UniProtKB/TrEMBL), A6K029 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386590 ⟸ NM_001399661
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I6A2G8 (UniProtKB/TrEMBL), A6K029 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-05-24
Ube2e2
ubiquitin-conjugating enzyme E2E 2
LOC683661
similar to ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast)
Data merged from RGD:1584491
1643240 APPROVED
2011-08-01
Ube2e2
ubiquitin-conjugating enzyme E2E 2
Ube2e2
ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-19
LOC683661
similar to ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast)
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-12-06
Ube2e2
ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast)
Ube2e2_predicted
ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast) (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Ube2e2_predicted
ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast) (predicted)
Symbol and Name status set to approved
70820 APPROVED
