Advanced Search (OLGA)

Gene: Tmem30a (transmembrane protein 30A) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Tmem30a

Name:

transmembrane protein 30A

RGD ID:

1303315

Description:

Predicted to enable aminophospholipid flippase activity and structural molecule activity. Predicted to be involved in several processes, including phospholipid transport; positive regulation of cellular component organization; and xenobiotic transmembrane transport. Predicted to be located in early endosome membrane and late endosome membrane. Predicted to be part of phospholipid-translocating ATPase complex. Predicted to be active in Golgi apparatus; endoplasmic reticulum; and plasma membrane. Orthologous to human TMEM30A (transmembrane protein 30A); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cell cycle control protein 50A; MGC94262; P4-ATPase flippase complex beta subunit TMEM30A; similar to RIKEN cDNA 2010200I23

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TMEM30A (transmembrane protein 30A)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Tmem30a (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TMEM30A (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TMEM30A (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tmem30a (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TMEM30A (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TMEM30A (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tmem30a (transmembrane protein 30A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TMEM30A (transmembrane protein 30A)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tmem30a (transmembrane protein 30A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tmem30aa (transmembrane protein 30Aa)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tmem30ab (transmembrane protein 30Ab)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDC50	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9947	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F20C5.4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	chat-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	LEM3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YNR048W	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tmem30a	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	89,608,975 - 89,637,421 (-)	NCBI		GRCr8
mRatBN7.2	8	80,728,749 - 80,757,197 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	80,729,619 - 80,753,248 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	86,255,298 - 86,279,557 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	84,532,448 - 84,556,707 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	82,355,077 - 82,379,336 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	87,222,107 - 87,245,953 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	87,223,948 - 87,245,951 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	86,765,764 - 86,789,809 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	84,827,711 - 84,849,715 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	84,847,166 - 84,869,170 (-)	NCBI
Celera	8	80,456,004 - 80,478,007 (-)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmem30a	Rat	Ullrich congenital muscular dystrophy 2		ISO	TMEM30A (Homo sapiens)	8554872	ClinVar Annotator: match by term: Ullrich congenital muscular dystrophy 2	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmem30a	Rat	(-)-demecolcine	increases expression	ISO	TMEM30A (Homo sapiens)	6480464	Demecolcine results in increased expression of TMEM30A mRNA	CTD	PMID:23649840
Tmem30a	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Tmem30a (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TMEM30A mRNA	CTD	PMID:36331819
Tmem30a	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Tmem30a (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of TMEM30A mRNA	CTD	PMID:22206623
Tmem30a	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Tmem30a (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of TMEM30A mRNA]	CTD	PMID:22206623
Tmem30a	Rat	17beta-estradiol	increases expression	ISO	Tmem30a (Mus musculus)	6480464	Estradiol results in increased expression of TMEM30A mRNA	CTD	PMID:39298647
Tmem30a	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Tmem30a (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of TMEM30A mRNA	CTD	PMID:18796159
Tmem30a	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of TMEM30A mRNA	CTD	PMID:33387578
Tmem30a	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of TMEM30A mRNA	CTD	PMID:34747641
Tmem30a	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	TMEM30A (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased expression of TMEM30A mRNA	CTD	PMID:19574409 more ...
Tmem30a	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Tmem30a (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of TMEM30A mRNA	CTD	PMID:19465110
Tmem30a	Rat	3-methylcholanthrene	multiple interactions	ISO	TMEM30A (Homo sapiens)	6480464	Methylcholanthrene promotes the reaction [AHR protein binds to TMEM30A promoter]	CTD	PMID:20348232
Tmem30a	Rat	3-methylcholanthrene	increases expression	ISO	TMEM30A (Homo sapiens)	6480464	Methylcholanthrene results in increased expression of TMEM30A mRNA	CTD	PMID:20348232
Tmem30a	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Tmem30a (Mus musculus)	6480464	bisphenol S results in increased expression of TMEM30A mRNA	CTD	PMID:39298647
Tmem30a	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TMEM30A mRNA	CTD	PMID:36041667
Tmem30a	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	TMEM30A (Homo sapiens)	6480464	bisphenol S results in increased methylation of TMEM30A gene	CTD	PMID:31601247
Tmem30a	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of TMEM30A mRNA	CTD	PMID:31881176
Tmem30a	Rat	aflatoxin B1	affects expression	ISO	TMEM30A (Homo sapiens)	6480464	Aflatoxin B1 affects the expression of TMEM30A protein	CTD	PMID:20106945
Tmem30a	Rat	aflatoxin M1	decreases expression	ISO	TMEM30A (Homo sapiens)	6480464	Aflatoxin M1 results in decreased expression of TMEM30A mRNA	CTD	PMID:30928695
Tmem30a	Rat	Aroclor 1254	decreases expression	ISO	Tmem30a (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of TMEM30A mRNA	CTD	PMID:23650126
Tmem30a	Rat	benzo[a]pyrene	increases expression	ISO	Tmem30a (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of TMEM30A mRNA	CTD	PMID:22228805
Tmem30a	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	TMEM30A (Homo sapiens)	6480464	7 more ...	CTD	PMID:20018196
Tmem30a	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of TMEM30A mRNA	CTD	PMID:25181051 more ...
Tmem30a	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TMEM30A mRNA	CTD	PMID:36041667
Tmem30a	Rat	bisphenol A	increases methylation	ISO	TMEM30A (Homo sapiens)	6480464	bisphenol A results in increased methylation of TMEM30A gene	CTD	PMID:31601247
Tmem30a	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TMEM30A mRNA	CTD	PMID:34947998
Tmem30a	Rat	bisphenol A	decreases expression	ISO	TMEM30A (Homo sapiens)	6480464	bisphenol A results in decreased expression of TMEM30A mRNA	CTD	PMID:29275510
Tmem30a	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of TMEM30A gene	CTD	PMID:28505145
Tmem30a	Rat	Bisphenol B	increases expression	ISO	TMEM30A (Homo sapiens)	6480464	bisphenol B results in increased expression of TMEM30A protein	CTD	PMID:34186270
Tmem30a	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TMEM30A mRNA	CTD	PMID:36041667
Tmem30a	Rat	bisphenol F	increases expression	ISO	TMEM30A (Homo sapiens)	6480464	bisphenol F results in increased expression of TMEM30A protein	CTD	PMID:34186270
Tmem30a	Rat	butanal	decreases expression	ISO	TMEM30A (Homo sapiens)	6480464	butyraldehyde results in decreased expression of TMEM30A mRNA	CTD	PMID:26079696
Tmem30a	Rat	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of TMEM30A mRNA	CTD	PMID:33453195
Tmem30a	Rat	carbon nanotube	increases expression	ISO	Tmem30a (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Tmem30a	Rat	clofibric acid	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TMEM30A mRNA	CTD	PMID:17602206
Tmem30a	Rat	copper atom	multiple interactions	ISO	Tmem30a (Mus musculus)	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of TMEM30A mRNA	CTD	PMID:15467011
Tmem30a	Rat	copper(0)	multiple interactions	ISO	Tmem30a (Mus musculus)	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of TMEM30A mRNA	CTD	PMID:15467011
Tmem30a	Rat	copper(II) sulfate	decreases expression	ISO	TMEM30A (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of TMEM30A mRNA	CTD	PMID:19549813
Tmem30a	Rat	coumestrol	decreases expression	ISO	TMEM30A (Homo sapiens)	6480464	Coumestrol results in decreased expression of TMEM30A mRNA	CTD	PMID:19167446
Tmem30a	Rat	cyclosporin A	decreases expression	ISO	TMEM30A (Homo sapiens)	6480464	Cyclosporine results in decreased expression of TMEM30A mRNA	CTD	PMID:25562108
Tmem30a	Rat	Dibutyl phosphate	affects expression	ISO	TMEM30A (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of TMEM30A mRNA	CTD	PMID:37042841
Tmem30a	Rat	dibutyl phthalate	increases expression	ISO	Tmem30a (Mus musculus)	6480464	Dibutyl Phthalate results in increased expression of TMEM30A mRNA	CTD	PMID:21266533
Tmem30a	Rat	diethylstilbestrol	decreases expression	ISO	TMEM30A (Homo sapiens)	6480464	Diethylstilbestrol results in decreased expression of TMEM30A mRNA	CTD	PMID:36621641
Tmem30a	Rat	diuron	decreases expression	ISO	TMEM30A (Homo sapiens)	6480464	Diuron results in decreased expression of TMEM30A mRNA	CTD	PMID:35967413
Tmem30a	Rat	dorsomorphin	multiple interactions	ISO	TMEM30A (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TMEM30A mRNA	CTD	PMID:27188386
Tmem30a	Rat	ethanol	affects splicing	ISO	Tmem30a (Mus musculus)	6480464	Ethanol affects the splicing of TMEM30A mRNA	CTD	PMID:30319688
Tmem30a	Rat	ethyl methanesulfonate	increases expression	ISO	TMEM30A (Homo sapiens)	6480464	Ethyl Methanesulfonate results in increased expression of TMEM30A mRNA	CTD	PMID:23649840
Tmem30a	Rat	fenthion	decreases expression	ISO	Tmem30a (Mus musculus)	6480464	Fenthion results in decreased expression of TMEM30A mRNA	CTD	PMID:34813904
Tmem30a	Rat	folic acid	multiple interactions	ISO	Tmem30a (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of TMEM30A mRNA]	CTD	PMID:22206623
Tmem30a	Rat	formaldehyde	increases expression	ISO	TMEM30A (Homo sapiens)	6480464	Formaldehyde results in increased expression of TMEM30A mRNA	CTD	PMID:23649840
Tmem30a	Rat	hydrogen peroxide	affects expression	ISO	TMEM30A (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of TMEM30A mRNA	CTD	PMID:20044591
Tmem30a	Rat	ivermectin	decreases expression	ISO	TMEM30A (Homo sapiens)	6480464	Ivermectin results in decreased expression of TMEM30A protein	CTD	PMID:32959892
Tmem30a	Rat	lead(0)	affects expression	ISO	TMEM30A (Homo sapiens)	6480464	Lead affects the expression of TMEM30A mRNA	CTD	PMID:28903495
Tmem30a	Rat	methapyrilene	decreases expression	EXP		6480464	Methapyrilene results in decreased expression of TMEM30A mRNA	CTD	PMID:30467583
Tmem30a	Rat	methidathion	decreases expression	ISO	Tmem30a (Mus musculus)	6480464	methidathion results in decreased expression of TMEM30A mRNA	CTD	PMID:34813904
Tmem30a	Rat	methyl methanesulfonate	increases expression	ISO	TMEM30A (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of TMEM30A mRNA	CTD	PMID:23649840
Tmem30a	Rat	methylphenidate	decreases expression	ISO	Tmem30a (Mus musculus)	6480464	Methylphenidate results in decreased expression of TMEM30A mRNA	CTD	PMID:22470460
Tmem30a	Rat	miconazole	decreases expression	ISO	Tmem30a (Mus musculus)	6480464	Miconazole results in decreased expression of TMEM30A mRNA	CTD	PMID:27462272
Tmem30a	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TMEM30A mRNA	CTD	PMID:17602206
Tmem30a	Rat	p-toluidine	decreases expression	EXP		6480464	4-toluidine results in decreased expression of TMEM30A mRNA	CTD	PMID:27638505
Tmem30a	Rat	paracetamol	increases expression	ISO	TMEM30A (Homo sapiens)	6480464	Acetaminophen results in increased expression of TMEM30A mRNA	CTD	PMID:22230336
Tmem30a	Rat	parathion	decreases expression	ISO	Tmem30a (Mus musculus)	6480464	Parathion results in decreased expression of TMEM30A mRNA	CTD	PMID:34813904
Tmem30a	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Tmem30a (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TMEM30A mRNA	CTD	PMID:36331819
Tmem30a	Rat	phenobarbital	affects expression	ISO	Tmem30a (Mus musculus)	6480464	Phenobarbital affects the expression of TMEM30A mRNA	CTD	PMID:23091169
Tmem30a	Rat	pirinixic acid	decreases expression	ISO	Tmem30a (Mus musculus)	6480464	pirinixic acid results in decreased expression of TMEM30A mRNA	CTD	PMID:18445702
Tmem30a	Rat	SB 431542	multiple interactions	ISO	TMEM30A (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TMEM30A mRNA	CTD	PMID:27188386
Tmem30a	Rat	titanium dioxide	decreases expression	ISO	Tmem30a (Mus musculus)	6480464	titanium dioxide results in decreased expression of TMEM30A mRNA	CTD	PMID:29264374
Tmem30a	Rat	trichostatin A	affects expression	ISO	TMEM30A (Homo sapiens)	6480464	trichostatin A affects the expression of TMEM30A mRNA	CTD	PMID:28542535
Tmem30a	Rat	Triptolide	increases expression	EXP		6480464	triptolide results in increased expression of TMEM30A protein	CTD	PMID:32519852
Tmem30a	Rat	valproic acid	affects expression	ISO	TMEM30A (Homo sapiens)	6480464	Valproic Acid affects the expression of TMEM30A mRNA	CTD	PMID:25979313
Tmem30a	Rat	valproic acid	increases expression	ISO	TMEM30A (Homo sapiens)	6480464	Valproic Acid results in increased expression of TMEM30A mRNA	CTD	PMID:23179753 more ...
Tmem30a	Rat	valproic acid	multiple interactions	ISO	TMEM30A (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TMEM30A mRNA	CTD	PMID:27188386
Tmem30a	Rat	zoledronic acid	increases expression	ISO	TMEM30A (Homo sapiens)	6480464	zoledronic acid results in increased expression of TMEM30A mRNA	CTD	PMID:20977926

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmem30a	Rat	aminophospholipid translocation	involved_in	IEA	GO:0015247	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Tmem30a	Rat	aminophospholipid transport	involved_in	ISO	TMEM30A (Homo sapiens)	1624291	PMID:20510206	RGD	PMID:20510206
Tmem30a	Rat	aminophospholipid transport	involved_in	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	lipid transport	involved_in	IEA	UniProtKB-KW:KW-0445	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tmem30a	Rat	phospholipid translocation	involved_in	ISO	TMEM30A (Homo sapiens)	1624291	PMID:20510206 and PMID:32493773	RGD	PMID:20510206 and PMID:32493773
Tmem30a	Rat	phospholipid translocation	acts_upstream_of_or_within	ISO	Tmem30a (Mus musculus)	1624291	PMID:23269685	RGD	PMID:23269685
Tmem30a	Rat	phospholipid translocation	involved_in	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	phospholipid translocation	involved_in	IBA	MGI:106402 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tmem30a	Rat	phospholipid translocation	acts_upstream_of_or_within	IEA	UniProtKB:Q8VEK0 and ensembl:ENSMUSP00000034878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	positive regulation of neuron projection development	involved_in	IEA	UniProtKB:Q8VEK0 and ensembl:ENSMUSP00000034878	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	positive regulation of neuron projection development	involved_in	ISO	Tmem30a (Mus musculus)	1624291	PMID:22641037	RGD	PMID:22641037
Tmem30a	Rat	positive regulation of phospholipid translocation	involved_in	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	positive regulation of phospholipid translocation	involved_in	ISO	TMEM30A (Homo sapiens)	1624291	PMID:25947375	RGD	PMID:25947375
Tmem30a	Rat	positive regulation of protein exit from endoplasmic reticulum	involved_in	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	positive regulation of protein exit from endoplasmic reticulum	involved_in	ISO	TMEM30A (Homo sapiens)	1624291	PMID:21914794	RGD	PMID:21914794
Tmem30a	Rat	protein localization to endosome	involved_in	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	protein localization to endosome	involved_in	ISO	TMEM30A (Homo sapiens)	1624291	PMID:21914794	RGD	PMID:21914794
Tmem30a	Rat	xenobiotic transmembrane transport	involved_in	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	xenobiotic transmembrane transport	involved_in	ISO	TMEM30A (Homo sapiens)	1624291	PMID:20510206	RGD	PMID:20510206

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmem30a	Rat	apical plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0015	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tmem30a	Rat	cell projection	located_in	IEA	UniProtKB-KW:KW-0966	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tmem30a	Rat	cytoplasmic vesicle	located_in	IEA	UniProtKB-KW:KW-0968	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tmem30a	Rat	early endosome membrane	located_in	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	early endosome membrane	located_in	ISO	TMEM30A (Homo sapiens)	1624291	PMID:31571211	RGD	PMID:31571211
Tmem30a	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	endoplasmic reticulum	is_active_in	IBA	PANTHER:PTN000100867 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tmem30a	Rat	endoplasmic reticulum	located_in	ISO	TMEM30A (Homo sapiens)	1624291	PMID:21914794	RGD	PMID:21914794
Tmem30a	Rat	Golgi apparatus	located_in	IEA	UniProtKB-KW:KW-0333	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tmem30a	Rat	Golgi apparatus	is_active_in	IBA	PANTHER:PTN000100867 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tmem30a	Rat	Golgi apparatus	located_in	IEA	UniProtKB-SubCell:SL-0132	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tmem30a	Rat	late endosome membrane	located_in	ISO	TMEM30A (Homo sapiens)	1624291	PMID:26567335	RGD	PMID:26567335
Tmem30a	Rat	late endosome membrane	located_in	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	membrane	located_in	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	membrane	located_in	IEA	InterPro:IPR005045	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tmem30a	Rat	membrane	located_in	ISO	TMEM30A (Homo sapiens)	1624291	PMID:25947375 and PMID:31571211	RGD	PMID:25947375 and PMID:31571211
Tmem30a	Rat	membrane	located_in	IEA	UniRule:UR000777781	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Tmem30a	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tmem30a	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tmem30a	Rat	phospholipid-translocating ATPase complex	part_of	ISO	TMEM30A (Homo sapiens)	1624291	PMID:20947505 more ...	RGD	PMID:20947505 more ...
Tmem30a	Rat	phospholipid-translocating ATPase complex	part_of	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	phospholipid-translocating ATPase complex	part_of	ISS	UniProtKB:Q9NV96	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tmem30a	Rat	photoreceptor inner segment	located_in	IEA	UniProtKB-SubCell:SL-0457	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tmem30a	Rat	photoreceptor outer segment	located_in	IEA	UniProtKB-SubCell:SL-0458	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tmem30a	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tmem30a	Rat	plasma membrane	located_in	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	plasma membrane	is_active_in	IBA	PANTHER:PTN000100867 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tmem30a	Rat	plasma membrane	located_in	ISO	TMEM30A (Homo sapiens)	1624291	PMID:20510206 more ...	RGD	PMID:20510206 more ...
Tmem30a	Rat	transport vesicle membrane	located_in	IEA	UniProtKB-SubCell:SL-0245	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tmem30a	Rat	aminophospholipid flippase activity	enables	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tmem30a	Rat	aminophospholipid flippase activity	enables	ISO	TMEM30A (Homo sapiens)	1624291	PMID:20510206	RGD	PMID:20510206
Tmem30a	Rat	protein binding	enables	ISO	TMEM30A (Homo sapiens) and UniProtKB:Q9NV96-1	1624291	UniProtKB:O94823-1 and PMID:32172343	RGD	PMID:32172343
Tmem30a	Rat	protein binding	enables	ISO	TMEM30A (Homo sapiens) and UniProtKB:Q9NV96-2	1624291	UniProtKB:P21145 more ...	RGD	PMID:32296183 and PMID:32814053
Tmem30a	Rat	protein binding	enables	ISO	TMEM30A (Homo sapiens)	1624291	UniProtKB:O43520 more ...	RGD	PMID:19731236 more ...
Tmem30a	Rat	protein binding	enables	ISO	Tmem30a (Mus musculus)	1624291	MGI:1330848 more ...	RGD	PMID:23269685 and PMID:30086173
Tmem30a	Rat	structural molecule activity	enables	ISO	TMEM30A (Homo sapiens)	1624291	PMID:32493773	RGD	PMID:32493773
Tmem30a	Rat	structural molecule activity	enables	IEA	UniProtKB:Q9NV96 and ensembl:ENSP00000230461	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:15489334	PMID:19946888	PMID:20510206	PMID:21914794	PMID:22641037	PMID:22871113	PMID:23269685

Tmem30a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	89,608,975 - 89,637,421 (-)	NCBI		GRCr8
mRatBN7.2	8	80,728,749 - 80,757,197 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	80,729,619 - 80,753,248 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	86,255,298 - 86,279,557 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	84,532,448 - 84,556,707 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	82,355,077 - 82,379,336 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	87,222,107 - 87,245,953 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	87,223,948 - 87,245,951 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	86,765,764 - 86,789,809 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	84,827,711 - 84,849,715 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	84,847,166 - 84,869,170 (-)	NCBI
Celera	8	80,456,004 - 80,478,007 (-)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

TMEM30A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	75,252,924 - 75,284,792 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	75,252,924 - 75,284,948 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	75,962,640 - 75,994,508 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	76,019,360 - 76,051,212 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	76,019,361 - 76,051,200	NCBI
Celera	6	76,356,050 - 76,388,034 (-)	NCBI		Celera
Cytogenetic Map	6	q14.1	NCBI
HuRef	6	73,161,451 - 73,193,435 (-)	NCBI		HuRef
CHM1_1	6	76,128,722 - 76,160,710 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	76,429,754 - 76,461,614 (-)	NCBI		T2T-CHM13v2.0

Tmem30a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	79,676,223 - 79,700,712 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	79,676,225 - 79,700,789 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	79,768,941 - 79,793,430 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	79,768,943 - 79,793,507 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	79,616,748 - 79,641,237 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	79,554,633 - 79,579,114 (-)	NCBI		MGSCv36	mm8
Celera	9	76,914,910 - 76,939,214 (-)	NCBI		Celera
Cytogenetic Map	9	E1	NCBI
cM Map	9	43.82	NCBI

TMEM30A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	95,299,954 - 95,332,044 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	93,177,736 - 93,209,830 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	73,096,128 - 73,128,202 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	76,387,063 - 76,419,282 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	76,390,241 - 76,418,939 (-)	Ensembl	panpan1.1		panPan2

TMEM30A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	36,898,136 - 36,932,189 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	36,888,092 - 36,931,936 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	36,775,533 - 36,811,838 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	37,600,304 - 37,636,641 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	37,599,568 - 37,636,452 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	37,003,886 - 37,040,195 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	36,995,300 - 37,031,351 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	37,123,319 - 37,159,632 (-)	NCBI		UU_Cfam_GSD_1.0

Tmem30a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	72,311,382 - 72,340,872 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936788	693,573 - 723,057 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936788	693,523 - 723,057 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMEM30A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	90,650,560 - 90,688,002 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	90,639,271 - 90,688,004 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	101,832,175 - 101,840,515 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TMEM30A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	4,877 - 36,725 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	4,127 - 37,368 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666058	5,816,997 - 5,848,879 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmem30a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624819	2,272,857 - 2,336,791 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Tmem30a
122 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	189
Count of miRNA genes:	131
Interacting mature miRNAs:	149
Transcripts:	ENSRNOT00000015299
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	75311777	84531599	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	75311938	82925521	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001004248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001399760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265186	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC108529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209432	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226768	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015299 ⟹ ENSRNOP00000015299

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	80,731,245 - 80,753,248 (-)	Ensembl
Rnor_6.0 Ensembl	8	87,223,948 - 87,245,951 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085725 ⟹ ENSRNOP00000070259

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	80,729,619 - 80,753,073 (-)	Ensembl
Rnor_6.0 Ensembl	8	87,224,341 - 87,245,774 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098005 ⟹ ENSRNOP00000084954

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	80,731,242 - 80,753,073 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100089 ⟹ ENSRNOP00000088051

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	80,731,245 - 80,753,248 (-)	Ensembl

RefSeq Acc Id:

NM_001004248 ⟹ NP_001004248

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	89,608,975 - 89,633,291 (-)	NCBI
mRatBN7.2	8	80,728,749 - 80,753,065 (-)	NCBI
Rnor_6.0	8	87,223,947 - 87,245,951 (-)	NCBI
Rnor_5.0	8	86,765,764 - 86,789,809 (-)	NCBI
RGSC_v3.4	8	84,827,711 - 84,849,715 (-)	RGD
Celera	8	80,456,004 - 80,478,007 (-)	RGD

Sequence:

show sequence

CAGGGTGCGTCCGCCTTTTCCCTCCCCCTTCCATCCTCCTCCCCCTCCCCTCCCCTCGTCCCTCAATCTTCTCCCTATTTCCTCTCTCTCCCTCCCTGGGGCGTCTCCTGAAGACTCCCGCTTCCGGT
CAGCGGCCGTCCGCAGAAGCGTGTCCCGCCTCTTCCGCCTCCCCGGTGGCGGCGCGGGTGGCGGAGGTAGTAGCGGCAGCGGCGACTGCGTGTCTCCTGTCAGGATCGGCAGGCAGGTCCTCTGGGCG
GCCCAGCTGGACGGGGCCGAGCCGAAGCCCGGGGGCCAATGGCGATGAACTATAGCGCGAAGGATGAGGTGGACGGCGGGCCCACGGGTCCTCCGGGGGGCGCCGCCAAGACCCGGAGGCCGGATAAC
ACGGCCTTCAAACAGCAACGGTTGCCTGCCTGGCAGCCCATCCTCACCGCCGGCACGGTGCTGCCCACCTTCTTCATCATCGGCCTCATCTTCATTCCCATCGGCATCGGCATCTTCGTCACCTCCAA
CAACATCCGTGAGATCGAGGGCAATGTGTTTATGTATTATGGACTGTCTAATTTCTATCAAAACCATCGTCGTTATGTGAAATCCCGAGATGATAGCCAGTTAAACGGAGACCCTAGTGCTTTGCTTA
ATCCAAGTAAGGAATGTGAACCCTATCGAAGAAATGAAGACAAACCGATTGCTCCATGTGGGGCCATTGCCAACAGCATGTTTAACGATACGTTAGAGTTGTTTCTGGTTGCCAATGAATCTGATCCC
AAGCCTGTGCCAATTCTTTTGAAGAAAAAAGGTATTGCTTGGTGGACAGATAAAAATGTGAAATTCAGAAATCCACCTGGAAAAGACAGCCTTCAAGAAAAGTTTAAAGATACAACAAAGCCAGTAAA
CTGGCATAAACCAGTATATGAGCTAGACCCTGATGATGAAAGTAATAATGGATTCATAAATGAAGACTTTATTGTTTGGATGCGTACTGCAGCTTTACCTACTTTTCGTAAGTTATATCGTCTTATAG
AGCGGACAGATGATTTACACCCAACACTACCAGCTGGACAGTACTATTTGAACATCACATACAATTACCCTGTACATTTTTTTGATGGACGAAAACGGATGATCTTGAGCACTATTTCATGGATGGGA
GGAAAGAATCCATTTTTGGGAATTGCTTACATCACTATTGGATCCATCTCCTTCCTTCTGGGAGTTGTACTGCTAGTAATTAATCATAAATATAGAAACAGTAGTAATACTGCTGACATCACCATTTA
ATTTTCTATTCTGAAACCAAATCTACTGCATGTGCATCAAGGCCAGTCCTGTTCAACCTAGCTTTTGAATGCCGATGTCTGGTTAGTATGTCATTTTGAAGTTGGCACATAACAAAAAACAGCCTTTG
TTCTTTGCTTCTTACATATGGATGACTTATGAAAATATATGATGGGTATAAAAATTAGCCATATTGATTATATCAATATTATAACTGCTAAAATGACATTCTAATGTCTGCTCTTTATTGGGACAGGC
CATGTGATGCATAGAGCCTCTTTCATGTGAAATGCGTCTACTGCTTAAACTGTTTATGCTGTGTGGATAACATTATATTGACATGATGCTGTATATGTGTGCCTACTGTGTGATGAAAGGGATTATGA
GATGTATGAGTGTAATGACTTGCTAACCTTTGAAAATTTGGTTACAGTTCAGATTGAAGAAAGACTAAATATAAATAAAACACTTCATCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001399760 ⟹ NP_001386689

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	89,608,975 - 89,633,291 (-)	NCBI
mRatBN7.2	8	80,728,749 - 80,753,065 (-)	NCBI

RefSeq Acc Id:

XM_039081159 ⟹ XP_038937087

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	89,609,630 - 89,637,419 (-)	NCBI
mRatBN7.2	8	80,731,238 - 80,757,197 (-)	NCBI

RefSeq Acc Id:

XM_063265186 ⟹ XP_063121256

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	89,609,630 - 89,637,421 (-)	NCBI


Protein RefSeqs	NP_001004248	(Get FASTA)	NCBI Sequence Viewer
	NP_001386689	(Get FASTA)	NCBI Sequence Viewer
	XP_038937087	(Get FASTA)	NCBI Sequence Viewer
	XP_063121256	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79203	(Get FASTA)	NCBI Sequence Viewer
	EDL77703	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015299.4
	ENSRNOP00000070259
	ENSRNOP00000084954
GenBank Protein	Q6AY41	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001004248 ⟸ NM_001004248
- Peptide Label:	isoform 2
- UniProtKB:	Q6AY41 (UniProtKB/Swiss-Prot), A0A8I6A8Z5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAMNYSAKDEVDGGPTGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIFIPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRNE DKPIAPCGAIANSMFNDTLELFLVANESDPKPVPILLKKKGIAWWTDKNVKFRNPPGKDSLQEKFKDTTKPVNWHKPVYELDPDDESNNGFINEDFIVWMRTAALPTFRKLYRLIERTDDLHPTLPAG QYYLNITYNYPVHFFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINHKYRNSSNTADITI hide sequence

Ensembl Acc Id:

ENSRNOP00000070259 ⟸ ENSRNOT00000085725

Ensembl Acc Id:

ENSRNOP00000015299 ⟸ ENSRNOT00000015299

RefSeq Acc Id:	XP_038937087 ⟸ XM_039081159
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000088051 ⟸ ENSRNOT00000100089

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AY41-F1-model_v2	AlphaFold	Q6AY41	1-328	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13696156

Promoter ID:

EPDNEW_R6674

Type:

initiation region

Name:

Tmem30a_1

Description:

transmembrane protein 30A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	87,245,776 - 87,245,836	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-29739	BioCyc
Ensembl Genes	ENSRNOG00000010895	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015299.6	UniProtKB/Swiss-Prot
	ENSRNOT00000085725	ENTREZGENE
	ENSRNOT00000098005	ENTREZGENE
IMAGE_CLONE	IMAGE:7131766	IMAGE-MGC_LOAD
InterPro	CDC50/LEM3_fam	UniProtKB/Swiss-Prot
KEGG Report	rno:300857	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94262	IMAGE-MGC_LOAD
NCBI Gene	300857	ENTREZGENE
PANTHER	PTHR10926	UniProtKB/Swiss-Prot
	PTHR10926:SF17	UniProtKB/Swiss-Prot
Pfam	CDC50	UniProtKB/Swiss-Prot
PhenoGen	Tmem30a	PhenoGen
PIRSF	DUF284_TM_euk	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000010895	RatGTEx
UniProt	A0A0G2JXG3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A2B0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A8Z5	ENTREZGENE, UniProtKB/TrEMBL
	A6I1M4	ENTREZGENE, UniProtKB/TrEMBL
	CC50A_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Tmem30a	transmembrane protein 30A	MGC94262	similar to RIKEN cDNA 2010200I23	Symbol and Name updated	1299863	APPROVED
2005-09-30	MGC94262				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar