Advanced Search (OLGA)

Gene: Cimip6 (ciliary microtubule inner protein 6) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Cimip6 (Ensembl: 4930505A04Rik)

Name:

ciliary microtubule inner protein 6 (Ensembl:RIKEN cDNA 4930505A04 gene)

RGD ID:

1626388

MGI Page

MGI

Description:

Predicted to be located in cilium. Is expressed in reproductive system; thyroid gland; and vascular system. Orthologous to human CIMIP6 (ciliary microtubule inner protein 6).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

4930505A04Rik; hypothetical protein LOC75087; RP23-145N4.1; uncharacterized protein C2orf73 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	30,376,006 - 30,421,829 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	30,376,006 - 30,421,827 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	30,426,006 - 30,471,829 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	30,426,006 - 30,471,827 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	30,326,006 - 30,371,829 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	30,326,007 - 30,371,808 (-)	NCBI		MGSCv36	mm8
Celera	11	32,816,887 - 32,864,602 (-)	NCBI		Celera
Cytogenetic Map	11	A4	NCBI
cM Map	11	17.93	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cimip6	Mouse	benzo[a]pyrene	decreases methylation	ISO	RGD:1603909	6480464	Benzo(a)pyrene results in decreased methylation of CIMIP6 promoter	CTD	PMID:27901495
Cimip6	Mouse	bisphenol A	decreases expression	ISO	RGD:1562229	6480464	bisphenol A results in decreased expression of CIMIP6 mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32528016\|PMID:34947998
Cimip6	Mouse	bromobenzene	increases expression	ISO	RGD:1562229	6480464	bromobenzene results in increased expression of CIMIP6 mRNA	CTD	PMID:32479839
Cimip6	Mouse	cadmium dichloride	decreases expression	ISO	RGD:1603909	6480464	Cadmium Chloride results in decreased expression of CIMIP6 mRNA	CTD	PMID:38382870
Cimip6	Mouse	lead diacetate	decreases expression	ISO	RGD:1562229	6480464	lead acetate results in decreased expression of CIMIP6 mRNA	CTD	PMID:22641619
Cimip6	Mouse	okadaic acid	decreases expression	ISO	RGD:1603909	6480464	Okadaic Acid results in decreased expression of CIMIP6 mRNA	CTD	PMID:38832940
Cimip6	Mouse	propanal	increases expression	ISO	RGD:1603909	6480464	propionaldehyde results in increased expression of CIMIP6 mRNA	CTD	PMID:26079696
Cimip6	Mouse	silicon dioxide	decreases expression	ISO	RGD:1603909	6480464	Silicon Dioxide analog results in decreased expression of CIMIP6 mRNA	CTD	PMID:25895662

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cimip6	Mouse	biological_process	involved_in	ND		2290270		MGI	GO_REF:0000015

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cimip6	Mouse	cellular_component	is_active_in	ND		2290270		MGI	GO_REF:0000015
Cimip6	Mouse	cilium	located_in	IEA	UniProtKB-SubCell:SL-0066	2290270		UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cimip6	Mouse	molecular_function	enables	ND		2290270		MGI	GO_REF:0000015

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cimip6	Mouse	decreased circulating alkaline phosphatase level		IEA		5509061		MGI
Cimip6	Mouse	decreased circulating glucose level		IEA		5509061		MGI
Cimip6	Mouse	tremors		IEA		5509061		MGI

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:12477932	PMID:16141072	PMID:16141073	PMID:21677750	PMID:24194600	PMID:27626380	PMID:32325033
PMID:38355793

Cimip6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	30,376,006 - 30,421,829 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	30,376,006 - 30,421,827 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	30,426,006 - 30,471,829 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	30,426,006 - 30,471,827 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	30,326,006 - 30,371,829 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	30,326,007 - 30,371,808 (-)	NCBI		MGSCv36	mm8
Celera	11	32,816,887 - 32,864,602 (-)	NCBI		Celera
Cytogenetic Map	11	A4	NCBI
cM Map	11	17.93	NCBI

CIMIP6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	54,330,884 - 54,384,193 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	54,330,034 - 54,383,742 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	54,558,021 - 54,588,718 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	54,411,575 - 54,442,218 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	54,398,902 - 54,427,568 (+)	NCBI		Celera
Cytogenetic Map	2	p16.2	NCBI
HuRef	2	54,292,744 - 54,321,407 (+)	NCBI		HuRef
CHM1_1	2	54,490,203 - 54,518,868 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	54,327,057 - 54,355,776 (+)	NCBI		T2T-CHM13v2.0

Cimip6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	108,346,759 - 108,379,914 (-)	NCBI		GRCr8
mRatBN7.2	14	104,145,818 - 104,178,973 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	104,145,818 - 104,178,973 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	108,465,704 - 108,498,890 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	109,713,329 - 109,746,593 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	106,185,751 - 106,219,016 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	114,834,781 - 114,868,335 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	114,834,771 - 114,868,328 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	114,495,982 - 114,529,238 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	111,535,886 - 111,569,348 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	14	103,011,067 - 103,044,144 (-)	NCBI		Celera
Cytogenetic Map	14	q22	NCBI

Cimip6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955441	20,013,678 - 20,042,946 (+)	Ensembl	ChiLan1.0
ChiLan1.0 Ensembl	NW_004955441	19,831,103 - 19,991,337 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955441	19,944,178 - 20,041,318 (+)	NCBI	ChiLan1.0	ChiLan1.0

CIMIP6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	71,964,211 - 71,999,014 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	71,968,175 - 72,002,978 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	54,482,328 - 54,513,857 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	55,628,347 - 55,659,820 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

C10H2orf73
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	55,247,128 - 55,272,124 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	55,246,741 - 55,272,107 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	55,198,937 - 55,223,929 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	56,246,364 - 56,271,353 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	10	55,938,187 - 55,963,168 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	56,226,053 - 56,251,220 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	56,518,521 - 56,543,701 (+)	NCBI		UU_Cfam_GSD_1.0

Cimip6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	27,734,960 - 27,778,511 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936491	793,799 - 827,139 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl

C3H2orf73
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	86,885,583 - 86,922,185 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	86,885,298 - 86,923,507 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	91,670,109 - 91,705,254 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CIMIP6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	52,533,743 - 52,615,128 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666045	59,126,277 - 59,155,274 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cimip6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624833	7,271,390 - 7,313,098 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624833	7,270,824 - 7,313,146 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Cimip6
1331 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	391
Count of miRNA genes:	250
Interacting mature miRNAs:	282
Transcripts:	ENSMUST00000041763, ENSMUST00000152718
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357844	Si5lq5_m	serum IGFBP-5 level QTL 5 (mouse)			Not determined		11	28165873	62165976	Mouse
1302171	Pgia28_m	proteoglycan induced arthritis 28 (mouse)			Not determined		11	8906097	42906218	Mouse
1357720	Kidpq1_m	kidney weight percentage QTL 1 (mouse)			Not determined		11	12268637	68500330	Mouse
1357851	Scfq3_m	subcutaneous fat pad weight QTL 3 (mouse)			Not determined		11	12268637	68500330	Mouse
12910804	Pwbwq16_m	post-weaning body weight QTL 16 (mouse)					11	27198057	50636094	Mouse
12910806	Pwbwq15_m	post-weaning body weight QTL 15 (mouse)					11	27198057	50636094	Mouse
12910801	Pwbwq14_m	post-weaning body weight QTL 14 (mouse)					11	27198057	50636094	Mouse
27226762	Feml21_m	femur length 21, 16 week (mouse)					11	11750000	65990826	Mouse
4141470	Egq4_m	early growth QTL 4 (mouse)			Not determined			12268637	68500330	Mouse
1301426	Desp2_m	despair 2 (mouse)			Not determined		11	28708581	62708700	Mouse
13524844	Ppiq9_m	prepulse inhibition QTL 9 (mouse)					11	9049997	35077325	Mouse
4142109	W10q2_m	weight 10 weeks QTL 2 (mouse)			Not determined			12268637	68500330	Mouse
12910817	Pwgrq20_m	post-weaning growth rate QTL 20 (mouse)					11	27198057	50636094	Mouse
1301814	Bbaa7_m	B.burgdorferi-associated arthritis 7 (mouse)			Not determined		11	26011780	44264695	Mouse
13208559	Wght10_m	weight 10 (mouse)					11	3950000	88890826	Mouse
10412216	Eae44_m	experimental allergic encephalomyelitis susceptibility 44 (mouse)			Not determined		11	12268637	39950840	Mouse
13208558	Lgth12_m	body length 12 (mouse)					11	3950000	94890826	Mouse
12910818	Ogrq5_m	overall growth rate QTL 5 (mouse)					11	27198057	50636094	Mouse
26884401	Huml4_m	humerus length 4, 10 week (mouse)					11	11550000	68490826	Mouse
10053687	Eae6_m	susceptibility to experimental allergic encephalomyelitis 6 (mouse)			Not determined		11	17781966	68500330	Mouse
27226798	Scvln18_m	sacral vertebrae length 2, 16 week (mouse)					11	3250000	60690826	Mouse
4141582	Lgaq1_m	late growth adjusted QTL 1 (mouse)			Not determined			12268637	68500330	Mouse
4141966	Tailq1_m	tail length QTL 1 (mouse)			Not determined			12268637	68500330	Mouse
1558945	Orgwq8_m	organ weight QTL 8 (mouse)			Not determined		11	17056175	67078411	Mouse
4142216	Lgq1_m	late growth QTL 1 (mouse)			Not determined			12268637	68500330	Mouse
1300905	Scc6_m	colon tumor susceptibility 6 (mouse)			Not determined		11	6880277	89019734	Mouse
14746971	Manh70_m	mandible shape 70 (mouse)					11	19905890	53905890	Mouse
13524848	Ppiq7_m	prepulse inhibition QTL 7 (mouse)					11	28569147	62569147	Mouse
39128214	Lwq20_m	liver weight QTL 20 (mouse)					11	12268637	118022724	Mouse
26884446	Sklq10_m	skull length QTL 10, 10 week (mouse)					11	3250000	62890826	Mouse
4141047	Nilac1_m	nicotine induced locomotor activity 1 (mouse)			Not determined		11	9011780	43011942	Mouse
10412246	Dfs2_m	dental fluorosis suseptibility 2 (mouse)			Not determined		11	21807364	95881231	Mouse
1559002	Lmrq4_m	Leishmania major resistance QTL 4 (mouse)			Not determined		11	12268637	69684947	Mouse
1300938	Bulb3_m	bulb size 3 (mouse)			Not determined		11	18578616	52578716	Mouse
1357518	Tgyl1_m	triglyceride level 1 (mouse)			Not determined		11	6880277	33916219	Mouse
4142308	W6q3_m	weight 6 weeks QTL 3 (mouse)			Not determined		11	12268637	68500330	Mouse
1357640	Orq2_m	ovulation rate QTL 2 (mouse)			Not determined		11	12268637	68500330	Mouse
1300599	Cocrb11_m	cocaine related behavior 11 (mouse)			Not determined		11	2670355	36671472	Mouse
1357437	Epfq4_m	epididymal fat pad weight QTL 4 (mouse)			Not determined		11	12268637	68500330	Mouse
4141398	Tgq22_m	triglyceride QTL 22 (mouse)			Not determined			21163406	55163406	Mouse
27226741	Metcl5_m	metatarsal-calcaneal length 5, 5 week (mouse)					11	4650000	46290827	Mouse
1300607	Tnbs2_m	tri-nitrobenzene sulfonic acid susceptible 2 (mouse)			Not determined		11	24898052	35126680	Mouse
1300990	Bits3_m	bitterness sensitivity 3 (mouse)			Not determined		11	8372121	42372260	Mouse
27226738	Metcl11_m	metatarsal-calcaneal length 11, 10 week (mouse)					11	8850000	61390826	Mouse
27226735	Metcl16_m	metatarsal-calcaneal length 16, 16 week (mouse)					11	5250000	35090827	Mouse
12801459	Leuf1_m	leukocyte filtration 1 (mouse)					11	18578616	52578716	Mouse
1300579	Thypr1_m	thymocyte proliferative response 1 (mouse)			Not determined		11	19282577	53282715	Mouse
10044008	Hbnr15_m	Heligmosomoides bakeri nematode resistance 15 (mouse)			Not determined		11	227052	34227232	Mouse
12801457	Intmrm2_m	intima/media ratio modifier 2 (mouse)					11	18578616	52578716	Mouse
12801460	Intim2_m	intima modifier 2 (mouse)					11	18578616	52578716	Mouse
27095909	Scvln6_m	sacral vertebrae length 2, 5 week (mouse)					11	3250000	44090827	Mouse
4141127	W3q4_m	weight 3 weeks QTL 4 (mouse)			Not determined			12268637	68500330	Mouse
4141894	Nidd6k_m	Nidd6 on KK-A (mouse)			Not determined			19124204	96897826	Mouse
13463479	Mchq19_m	mean corpuscular hemoglobin QTL 19 (mouse)					11	10951232	44951464	Mouse
25394552	Skmw69_m	skeletal muscle weight 69, TA (mouse)					11	29699029	32329535	Mouse
27095904	Scvln12_m	sacral vertebrae length 2, 10 week (mouse)					11	3250000	34495048	Mouse
13463472	Mcvq15_m	mean corpuscular volume QTL 15 (mouse)					11	10951232	44951464	Mouse
26884453	Sklq16_m	skull length QTL 16, 16 week (mouse)					11	3250000	72690826	Mouse
10044006	Hbnr13_m	Heligmosomoides bakeri nematode resistance 13 (mouse)			Not determined		11	25772626	59772741	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_001100394	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AK015698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL844147	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC049719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000041763 ⟹ ENSMUSP00000045288

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	30,376,006 - 30,421,808 (-)	Ensembl
GRCm38.p6 Ensembl	11	30,426,006 - 30,471,808 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000152718 ⟹ ENSMUSP00000117004

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	30,376,006 - 30,421,827 (-)	Ensembl
GRCm38.p6 Ensembl	11	30,426,006 - 30,471,827 (-)	Ensembl

RefSeq Acc Id:

NM_001100394 ⟹ NP_001093864

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	30,376,006 - 30,421,829 (-)	NCBI
GRCm38	11	30,426,006 - 30,471,829 (-)	ENTREZGENE
MGSCv37	11	30,326,006 - 30,371,829 (-)	RGD
Celera	11	32,816,887 - 32,864,602 (-)	RGD
cM Map	11		ENTREZGENE

Sequence:

show sequence

AGCAAGAATAGGTCAGTGTTCTCTCTTGACACTCCTAGCTGCCACGTGGCAGGCTGGAGGGGGCCATGGAGGGAGAGGAGAAGCAGCAACAGCATAAAACAGAAGATGATGGTATAGCGTGTGTAGCT
GAAAGAAAAGTAGAAATCAAAAATGAAAAAAGTCCTGGGAAAAGCACACAACACCCAAAACCATGTGTGGACAGAAGACGTGTAAATTATGCTAAATTCATACACACAAATGCAAGAACATACAACGA
GCCAGTTCCCTACATTGATAATAAAGGGCCAGAAAAGCAGAGAAAATGGTGGTTCCATAATGAAGCACCAAAACATGTCTCCCAACCATCTTATGACACCAAAAGTGTCCAGCGGAGTGACTTCCAGA
AGCCAGCATGCCCATTGGTTTTGCCAGTCAAACACAGCCGGATGCAAAAGCCTTCTTGTGGAATAGTTCCACTTACCAGTCTGGATGTATCAGGAGAACATGAGAACAATTTTGTAGAATACATCTCT
TTTATACATCAATATGATGCCAGGAGAACTCCCAATGAACCCATCAAAGGAAAGAAACATGGAACCTTCGTGCAGAGAGAGATAAAACTAGGGGCTATGCCAATAGTTCCTAAGGCACCGGAGGTATT
ATTGAACACTCTAGAGTCAGGTTCATCAGAACAGCCCCAAAAAACAGACAAAGGAAATTCATCAGGAGACAAAGTGACCTCACCAGGCCTATGCCAACAGAATTCCCAAGAGTTGCTGGAGACTTAGA
ACAGCTTATCAGCACGAGAAGGCAGCCCAGCCCAGCAGACCCAGAAGCCTGGGTCTGGGAGATGACTGGAAGAGTGTTGCTCTCAACTGGAGGGCAAGCTCTTCTCACCAGGCACGGGCCTTTAAACC
ACTAATAAAAAAGTCAGGGTAAGTGAGGAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001093864	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAB29936	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000045288
	ENSMUSP00000045288.8
GenBank Protein	Q5SPV6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001093864 ⟸ NM_001100394

- UniProtKB:

Q810N4 (UniProtKB/Swiss-Prot), Q9D580 (UniProtKB/Swiss-Prot), Q5SPV6 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MEGEEKQQQHKTEDDGIACVAERKVEIKNEKSPGKSTQHPKPCVDRRRVNYAKFIHTNARTYNEPVPYIDNKGPEKQRKWWFHNEAPKHVSQPSYDTKSVQRSDFQKPACPLVLPVKHSRMQKPSCGI
VPLTSLDVSGEHENNFVEYISFIHQYDARRTPNEPIKGKKHGTFVQREIKLGAMPIVPKAPEVLLNTLESGSSEQPQKTDKGNSSGDKVTSPGLCQQNSQELLET

hide sequence

Ensembl Acc Id:

ENSMUSP00000117004 ⟸ ENSMUST00000152718

Ensembl Acc Id:

ENSMUSP00000045288 ⟸ ENSMUST00000041763

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5SPV6-F1-model_v2	AlphaFold	Q5SPV6	1-233	view protein structure

RGD ID:

6820189

Promoter ID:

MM_KWN:6821

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Brain, Kidney, Lung, MEF_B4, MEF_B6

Transcripts:

ENSMUST00000041763, OTTMUST00000011924

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	11	30,371,744 - 30,372,244 (-)	MPROMDB

RGD ID:

8674192

Promoter ID:

EPDNEW_M15127

Type:

initiation region

Name:

4930505A04Rik_1

Description:

Mus musculus RIKEN cDNA 4930505A04 gene , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	11	30,471,881 - 30,471,941	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000040919	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000041763	ENTREZGENE
	ENSMUST00000041763.14	UniProtKB/Swiss-Prot
InterPro	GDWWSH	UniProtKB/Swiss-Prot
KEGG Report	mmu:75087	UniProtKB/Swiss-Prot
MGD	MGI:1922337	ENTREZGENE
NCBI Gene	75087	ENTREZGENE
PANTHER	PTHR35087	UniProtKB/Swiss-Prot
	SIMILAR TO HYPOTHETICAL PROTEIN FLJ40298	UniProtKB/Swiss-Prot
Pfam	GDWWSH	UniProtKB/Swiss-Prot
PhenoGen	Cimip6	PhenoGen
UniProt	CB073_MOUSE	UniProtKB/Swiss-Prot
	F2Z426_MOUSE	UniProtKB/TrEMBL
	Q5SPV6	ENTREZGENE
	Q810N4	ENTREZGENE
	Q9D580	ENTREZGENE
UniProt Secondary	Q810N4	UniProtKB/Swiss-Prot
	Q9D580	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2024-09-23	Cimip6	ciliary microtubule inner protein 6	4930505A04Rik	RIKEN cDNA 4930505A04 gene	Symbol and/or name updated	27372883	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Mammalian Phenotype