No known orthologs.
Symbol: |
Krtap20-22 |
Name: |
keratin associated protein 20-22 |
RGD ID: |
1623415 |
MGI Page |
MGI |
Description: |
Orthologous to human KRTAP20-1 (keratin associated protein 20-1). |
Type: |
protein-coding
|
RefSeq Status: |
MODEL |
Previously known as: |
EG665661; Gm7735; keratin-associated protein 20-2-like; predicted gene, EG665661 |
RGD Orthologs |
|
Alliance Orthologs |
|
More Info |
homologs ...
|
More Info |
|
Latest Assembly: |
GRCm39 - Mouse Genome Assembly GRCm39 |
Position: |
Mouse Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
GRCm39 | 16 | 88,966,378 - 88,966,536 (+) | NCBI | GRCm39 | GRCm39 | mm39 | | GRCm39 Ensembl | 16 | 88,966,378 - 88,966,536 (+) | Ensembl | | GRCm39 Ensembl | | | GRCm38 | 16 | 89,169,490 - 89,169,648 (+) | NCBI | GRCm38 | GRCm38 | mm10 | GRCm38 | GRCm38.p6 Ensembl | 16 | 89,169,490 - 89,169,648 (+) | Ensembl | GRCm38 | | mm10 | GRCm38 | MGSCv37 | 16 | 89,169,735 - 89,169,893 (+) | NCBI | GRCm37 | MGSCv37 | mm9 | NCBIm37 | MGSCv36 | 16 | 89,058,349 - 89,058,507 (+) | NCBI | | MGSCv36 | mm8 | | Celera | 16 | 89,372,406 - 89,372,564 (+) | NCBI | | Celera | | | Cytogenetic Map | 16 | C3.3 | NCBI | | | | | cM Map | 16 | 51.42 | NCBI | | | | |
|
JBrowse: |
View Region in Genome Browser (JBrowse)
|
Model |
|
.
Predicted Target Of
Count of predictions: | 65 | Count of miRNA genes: | 62 | Interacting mature miRNAs: | 65 | Transcripts: | ENSMUST00000089098 | Prediction methods: | Miranda, Rnahybrid, Targetscan | Result types: | miRGate_prediction |
1302194 | Pgia10_m | proteoglycan induced arthritis 10 (mouse) | | | Not determined | | 16 | 68600722 | 98008968 | Mouse | 26884376 | Skwq4_m | skull length QTL 4, 5 week (mouse) | | | | | 16 | 8417864 | 90896888 | Mouse | 1302096 | Aod1a_m | autoimmune ovarian dysgenesis 1a (mouse) | | | Not determined | | 16 | 35446643 | 92573008 | Mouse | 1558740 | Bpq9_m | blood pressure QTL 9 (mouse) | | | Not determined | | 16 | 63327336 | 97327472 | Mouse | 4141113 | Tgq28_m | triglyceride QTL 28 (mouse) | | | Not determined | | | 62986646 | 96986646 | Mouse | 1301364 | Lith14_m | lithogenic gene 14 (mouse) | | | Not determined | | 16 | 55661846 | 89661961 | Mouse | 4142262 | Lmr18_m | leishmaniasis resistance 18 (mouse) | | | Not determined | | 16 | 69127611 | 98008968 | Mouse | 11049573 | Lmr18b_m | leishmaniasis resistance 18b (mouse) | | | | | 16 | 69127611 | 98008968 | Mouse | 1301598 | Renf2_m | renal failure 2 (mouse) | | | Not determined | | 16 | 70380252 | 98008968 | Mouse | 11049574 | Lmr18a_m | leishmaniasis resistance 18a (mouse) | | | | | 16 | 69127611 | 98008968 | Mouse | 11522753 | Cocia19_m | cocaine-induced activity, QTL 19 (mouse) | | | | | 16 | 69254482 | 98008968 | Mouse | 1300928 | Etia_m | ethanol induced activation (mouse) | | | Not determined | | 16 | 63313907 | 97314016 | Mouse | 1301125 | Sluc27_m | susceptibility to lung cancer 27 (mouse) | | | Not determined | | 16 | 61608644 | 95608764 | Mouse | 1301032 | Tauph_m | tau phosphorylation (mouse) | | | Not determined | | 16 | 69076132 | 98008968 | Mouse |
Ensembl Acc Id: |
ENSMUST00000089098 ⟹ ENSMUSP00000086499 |
Type: |
CODING |
Position: |
Mouse Assembly | Chr | Position (strand) | Source |
---|
GRCm39 Ensembl | 16 | 88,966,378 - 88,966,536 (+) | Ensembl | GRCm38.p6 Ensembl | 16 | 89,169,490 - 89,169,648 (+) | Ensembl |
|
RefSeq Acc Id: |
XM_006523124 ⟹ XP_006523187 |
Type: |
CODING |
Position: |
Mouse Assembly | Chr | Position (strand) | Source |
---|
GRCm39 | 16 | 88,966,378 - 88,966,536 (+) | NCBI |
|
Sequence: |
ATGTGCTACTACAGAGGATATTATGGAGGCCTGGGCTATGGCTATGGTGGCCTAGGCTGTGGCTATGGCTGTGGCTATGGCTGTGGCTATGGTGGCTATGGATATGGCTGCTGCCGCCCACTGTGCTG TGGAAGATACTGGTCTTATGGCTTCTACTGA
hide sequence
|
Ensembl Acc Id: |
ENSMUSP00000086499 ⟸ ENSMUST00000089098 |
|
RefSeq Acc Id: |
XP_006523187 ⟸ XM_006523124 |
- UniProtKB: |
D3YX18 (UniProtKB/TrEMBL) |
- Sequence: |
MCYYRGYYGGLGYGYGGLGCGYGCGYGCGYGGYGYGCCRPLCCGRYWSYGFY
hide sequence
|
|
Date |
Current Symbol |
Current Name |
Previous Symbol |
Previous Name |
Description |
Reference |
Status |
2024-02-26 |
Krtap20-22 |
keratin associated protein 20-22 |
Gm7735 |
predicted gene 7735 |
Symbol and/or name updated |
27372883 |
PROVISIONAL |
|
|