Symbol:
Vash1
Name:
vasohibin 1
RGD ID:
1620582
MGI Page
MGI
Description:
Enables actin binding activity and metallocarboxypeptidase activity. Involved in proteolysis. Acts upstream of or within labyrinthine layer blood vessel development and negative regulation of angiogenesis. Predicted to be located in apical part of cell; endoplasmic reticulum; and extracellular space. Predicted to be active in cytoplasm. Is expressed in nervous system and retina. Human ortholog(s) of this gene implicated in liver cirrhosis and portal hypertension. Orthologous to human VASH1 (vasohibin 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AI834978; D930046M13Rik; G630009D10Rik; RIKEN cDNA D930046M13 gene; TTCP 1; tubulinyl-Tyr carboxypeptidase 1; tyrosine carboxypeptidase 1; vasohibin-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
VASH1 (vasohibin 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Vash1 (vasohibin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Vash1 (vasohibin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
VASH1 (vasohibin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
VASH1 (vasohibin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Vash1 (vasohibin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
VASH1 (vasohibin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
VASH1 (vasohibin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Vash1 (vasohibin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
VASH1 (vasohibin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Vash1 (vasohibin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
vash1 (vasohibin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Xenopus tropicalis (tropical clawed frog):
vash1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 86,725,474 - 86,742,462 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 86,725,474 - 86,738,865 (+) Ensembl GRCm39 Ensembl GRCm38 12 86,678,700 - 86,695,688 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 86,678,700 - 86,692,091 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 88,019,650 - 88,036,631 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 87,567,803 - 87,581,194 (+) NCBI MGSCv36 mm8 Celera 12 88,140,378 - 88,157,636 (+) NCBI Celera Cytogenetic Map 12 D2 NCBI cM Map 12 40.84 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Vash1 Mouse 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane multiple interactions ISO Vash1 (Rattus norvegicus) 6480464 2 more ... CTD PMID:19414516 Vash1 Mouse 1,2-dichloroethane increases expression EXP 6480464 ethylene dichloride results in increased expression of VASH1 mRNA CTD PMID:28960355 Vash1 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of VASH1 mRNA CTD PMID:22206623 Vash1 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of VASH1 mRNA CTD PMID:17555576 Vash1 Mouse 17beta-estradiol multiple interactions ISO VASH1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of VASH1 mRNA CTD PMID:20660070 Vash1 Mouse 17beta-estradiol multiple interactions ISO Vash1 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of VASH1 mRNA CTD PMID:32741896 Vash1 Mouse 17beta-estradiol 3-benzoate multiple interactions ISO Vash1 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of VASH1 mRNA CTD PMID:32741896 Vash1 Mouse 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO VASH1 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Vash1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of VASH1 mRNA CTD PMID:24680724 Vash1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Vash1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of VASH1 mRNA CTD PMID:33387578 Vash1 Mouse 2-methylcholine affects expression ISO VASH1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of VASH1 mRNA CTD PMID:21179406 Vash1 Mouse 3',5'-cyclic AMP multiple interactions ISO Vash1 (Rattus norvegicus) 6480464 2 more ... CTD PMID:19414516 Vash1 Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of VASH1 mRNA CTD PMID:20188158 Vash1 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of VASH1 mRNA CTD PMID:28973697 Vash1 Mouse 5-aza-2'-deoxycytidine affects expression ISO VASH1 (Homo sapiens) 6480464 Decitabine affects the expression of VASH1 mRNA CTD PMID:23300844 Vash1 Mouse acrylamide decreases expression ISO VASH1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of VASH1 mRNA CTD PMID:32763439 Vash1 Mouse aflatoxin B1 decreases expression ISO VASH1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of VASH1 mRNA CTD PMID:21641981 Vash1 Mouse arsane affects expression ISO VASH1 (Homo sapiens) 6480464 Arsenic affects the expression of VASH1 mRNA CTD PMID:18414638 Vash1 Mouse arsane multiple interactions ISO VASH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of VASH1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of VASH1 mRNA CTD PMID:39836092 Vash1 Mouse arsenic atom affects expression ISO VASH1 (Homo sapiens) 6480464 Arsenic affects the expression of VASH1 mRNA CTD PMID:18414638 Vash1 Mouse arsenic atom multiple interactions ISO VASH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of VASH1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of VASH1 mRNA CTD PMID:39836092 Vash1 Mouse arsenous acid decreases expression ISO VASH1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of VASH1 mRNA CTD PMID:22521957 Vash1 Mouse benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of VASH1 mRNA CTD PMID:27858113 Vash1 Mouse benzo[a]pyrene decreases methylation ISO VASH1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of VASH1 exon CTD PMID:27901495 Vash1 Mouse benzo[a]pyrene affects methylation ISO VASH1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of VASH1 promoter CTD PMID:27901495 Vash1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of VASH1 mRNA CTD PMID:32417428 Vash1 Mouse benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of VASH1 mRNA CTD PMID:27858113 Vash1 Mouse Benzo[k]fluoranthene decreases expression EXP 6480464 benzo(k)fluoranthene results in decreased expression of VASH1 mRNA CTD PMID:26377693 Vash1 Mouse bisphenol A decreases expression ISO Vash1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of VASH1 mRNA CTD PMID:25181051 and PMID:30816183 Vash1 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of VASH1 mRNA CTD PMID:32156529 Vash1 Mouse bisphenol A increases expression ISO Vash1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of VASH1 mRNA CTD PMID:34947998 Vash1 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Vash1 Mouse chrysene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of VASH1 mRNA CTD PMID:27858113 Vash1 Mouse cisplatin affects expression ISO VASH1 (Homo sapiens) 6480464 Cisplatin affects the expression of VASH1 mRNA CTD PMID:23300844 Vash1 Mouse clobetasol increases expression EXP 6480464 Clobetasol results in increased expression of VASH1 mRNA CTD PMID:27462272 Vash1 Mouse diarsenic trioxide decreases expression ISO VASH1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of VASH1 mRNA CTD PMID:22521957 Vash1 Mouse diazinon decreases methylation ISO VASH1 (Homo sapiens) 6480464 Diazinon results in decreased methylation of VASH1 gene CTD PMID:22964155 Vash1 Mouse dorsomorphin multiple interactions ISO VASH1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Vash1 Mouse endosulfan decreases expression ISO Vash1 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of VASH1 mRNA CTD PMID:29391264 Vash1 Mouse entinostat decreases expression ISO VASH1 (Homo sapiens) 6480464 entinostat results in decreased expression of VASH1 mRNA CTD PMID:26272509 and PMID:27188386 Vash1 Mouse entinostat multiple interactions ISO VASH1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of VASH1 mRNA CTD PMID:27188386 Vash1 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of VASH1 mRNA CTD PMID:30319688 Vash1 Mouse finasteride decreases expression ISO Vash1 (Rattus norvegicus) 6480464 Finasteride results in decreased expression of VASH1 mRNA CTD PMID:24136188 Vash1 Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of VASH1 mRNA CTD PMID:22206623 Vash1 Mouse folic acid decreases expression ISO VASH1 (Homo sapiens) 6480464 Folic Acid results in decreased expression of VASH1 mRNA CTD PMID:21867686 Vash1 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of VASH1 mRNA CTD PMID:25629700 Vash1 Mouse fonofos increases methylation ISO VASH1 (Homo sapiens) 6480464 Fonofos results in increased methylation of VASH1 promoter CTD PMID:22847954 Vash1 Mouse FR900359 affects phosphorylation ISO VASH1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of VASH1 protein CTD PMID:37730182 Vash1 Mouse gentamycin decreases expression ISO Vash1 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of VASH1 mRNA CTD PMID:33387578 Vash1 Mouse lipopolysaccharide decreases expression ISO VASH1 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of VASH1 mRNA CTD PMID:35811015 Vash1 Mouse lipopolysaccharide multiple interactions ISO VASH1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Vash1 Mouse manganese atom multiple interactions ISO VASH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of VASH1 mRNA CTD PMID:39836092 Vash1 Mouse manganese(0) multiple interactions ISO VASH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of VASH1 mRNA CTD PMID:39836092 Vash1 Mouse manganese(II) chloride multiple interactions ISO VASH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of VASH1 mRNA CTD PMID:39836092 Vash1 Mouse mercury dibromide decreases expression ISO VASH1 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of VASH1 mRNA CTD PMID:26272509 Vash1 Mouse mercury dibromide multiple interactions ISO VASH1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of VASH1 mRNA CTD PMID:27188386 Vash1 Mouse methoxychlor affects methylation ISO Vash1 (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of VASH1 gene CTD PMID:35440735 Vash1 Mouse methylphenidate increases expression EXP 6480464 Methylphenidate results in increased expression of VASH1 mRNA CTD PMID:22470460 Vash1 Mouse miconazole increases expression EXP 6480464 Miconazole results in increased expression of VASH1 mRNA CTD PMID:27462272 Vash1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of VASH1 mRNA CTD PMID:17562736 Vash1 Mouse parathion increases methylation ISO VASH1 (Homo sapiens) 6480464 Parathion results in increased methylation of VASH1 promoter CTD PMID:22847954 Vash1 Mouse phenylmercury acetate decreases expression ISO VASH1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of VASH1 mRNA CTD PMID:26272509 Vash1 Mouse phenylmercury acetate multiple interactions ISO VASH1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of VASH1 mRNA CTD PMID:27188386 Vash1 Mouse progesterone multiple interactions ISO VASH1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of VASH1 mRNA CTD PMID:20660070 Vash1 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO VASH1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Vash1 Mouse S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO VASH1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of VASH1 mRNA CTD PMID:35811015 Vash1 Mouse SB 431542 multiple interactions ISO VASH1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Vash1 Mouse sodium arsenite multiple interactions ISO VASH1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of VASH1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of VASH1 mRNA CTD PMID:39836092 Vash1 Mouse Soman decreases expression ISO Vash1 (Rattus norvegicus) 6480464 Soman results in decreased expression of VASH1 mRNA CTD PMID:19281266 Vash1 Mouse sulindac decreases expression ISO Vash1 (Rattus norvegicus) 6480464 Sulindac results in decreased expression of VASH1 mRNA CTD PMID:24136188 Vash1 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of VASH1 mRNA CTD PMID:17555576 Vash1 Mouse terbufos increases methylation ISO VASH1 (Homo sapiens) 6480464 terbufos results in increased methylation of VASH1 promoter CTD PMID:22847954 Vash1 Mouse testosterone multiple interactions ISO Vash1 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of VASH1 mRNA CTD PMID:32741896 Vash1 Mouse tetraphene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of VASH1 mRNA CTD PMID:27858113 Vash1 Mouse thioacetamide increases expression ISO Vash1 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of VASH1 mRNA CTD PMID:34492290 Vash1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of VASH1 gene and titanium dioxide results in decreased methylation of VASH1 promoter CTD PMID:35295148 Vash1 Mouse trichostatin A decreases expression ISO VASH1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of VASH1 mRNA CTD PMID:24935251 Vash1 Mouse trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of VASH1 mRNA CTD PMID:35537566 Vash1 Mouse valproic acid decreases expression ISO VASH1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of VASH1 mRNA CTD PMID:23179753 and PMID:26272509 Vash1 Mouse valproic acid multiple interactions ISO VASH1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of VASH1 mRNA CTD PMID:27188386 Vash1 Mouse zoledronic acid increases expression ISO VASH1 (Homo sapiens) 6480464 zoledronic acid results in increased expression of VASH1 mRNA CTD PMID:20977926
1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (ISO) 1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 3',5'-cyclic AMP (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4-hydroxyphenyl retinamide (EXP) 5-aza-2'-deoxycytidine (ISO) acrylamide (ISO) aflatoxin B1 (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (EXP) Benzo[k]fluoranthene (EXP) bisphenol A (EXP,ISO) carbon nanotube (EXP) chrysene (EXP) cisplatin (ISO) clobetasol (EXP) diarsenic trioxide (ISO) diazinon (ISO) dorsomorphin (ISO) endosulfan (ISO) entinostat (ISO) ethanol (EXP) finasteride (ISO) folic acid (EXP,ISO) fonofos (ISO) FR900359 (ISO) gentamycin (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dibromide (ISO) methoxychlor (ISO) methylphenidate (EXP) miconazole (EXP) paracetamol (EXP) parathion (ISO) phenylmercury acetate (ISO) progesterone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenite (ISO) Soman (ISO) sulindac (ISO) tamoxifen (EXP) terbufos (ISO) testosterone (ISO) tetraphene (EXP) thioacetamide (ISO) titanium dioxide (EXP) trichostatin A (ISO) trovafloxacin (EXP) valproic acid (ISO) zoledronic acid (ISO)
Vash1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 86,725,474 - 86,742,462 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 86,725,474 - 86,738,865 (+) Ensembl GRCm39 Ensembl GRCm38 12 86,678,700 - 86,695,688 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 86,678,700 - 86,692,091 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 88,019,650 - 88,036,631 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 87,567,803 - 87,581,194 (+) NCBI MGSCv36 mm8 Celera 12 88,140,378 - 88,157,636 (+) NCBI Celera Cytogenetic Map 12 D2 NCBI cM Map 12 40.84 NCBI
VASH1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 76,761,468 - 76,783,015 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 76,761,468 - 76,783,015 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 77,227,811 - 77,249,358 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 76,298,285 - 76,319,111 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 76,298,284 - 76,319,109 NCBI Celera 14 57,266,828 - 57,287,976 (+) NCBI Celera Cytogenetic Map 14 q24.3 NCBI HuRef 14 57,396,835 - 57,417,983 (+) NCBI HuRef CHM1_1 14 77,166,049 - 77,187,187 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 70,970,762 - 70,992,327 (+) NCBI T2T-CHM13v2.0
Vash1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 112,060,086 - 112,076,689 (+) NCBI GRCr8 mRatBN7.2 6 106,330,374 - 106,345,740 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 106,329,123 - 106,345,726 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 6 110,624,377 - 110,640,942 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 110,624,856 - 110,637,382 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 119,921,674 - 119,938,204 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 110,806,294 - 110,818,161 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 6 104,151,889 - 104,168,420 (+) NCBI Celera Cytogenetic Map 6 q31 NCBI
Vash1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955438 752,554 - 772,937 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955438 753,392 - 772,937 (+) NCBI ChiLan1.0 ChiLan1.0
VASH1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 77,846,765 - 77,868,086 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 77,063,264 - 77,084,593 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 57,315,866 - 57,337,465 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 76,522,881 - 76,544,254 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 76,522,881 - 76,544,251 (+) Ensembl panpan1.1 panPan2
VASH1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 49,631,029 - 49,651,693 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 49,631,910 - 49,648,168 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 49,314,932 - 49,335,554 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 49,857,895 - 49,878,478 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 49,858,702 - 49,881,810 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 49,528,855 - 49,548,413 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 49,551,007 - 49,571,590 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 49,949,126 - 49,969,713 (+) NCBI UU_Cfam_GSD_1.0
Vash1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 26,372,770 - 26,393,180 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936488 5,675,782 - 5,696,222 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936488 5,675,788 - 5,696,198 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
VASH1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 99,910,497 - 99,929,770 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 99,910,644 - 99,933,633 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 105,958,917 - 105,978,036 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
VASH1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 54,025,548 - 54,047,122 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 54,026,617 - 54,047,135 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 42,224,646 - 42,246,437 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Vash1
.
Predicted Target Of
Count of predictions: 226 Count of miRNA genes: 204 Interacting mature miRNAs: 220 Transcripts: ENSMUST00000021681 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
39128213 Lwq23_m liver weight QTL 10 (mouse) 12 80956708 113383533 Mouse 1300883 Ath21_m atherosclerosis 21 (mouse) Not determined 12 85961579 119961683 Mouse 14746976 Manh73_m mandible shape 73 (mouse) 12 65857131 99857131 Mouse 27226776 Tibl6_m tibia length 6, 5 week (mouse) 12 60646786 92666774 Mouse 1301337 Cdcs8_m cytokine deficiency colitis susceptibility 8 (mouse) Not determined 12 64689083 98689229 Mouse 1300633 Cdcs7_m cytokine deficiency colitis susceptibility 7 (mouse) Not determined 12 64689083 98689229 Mouse 25823169 Hrsq8_m host response to SARS QTL 8, log titer (mouse) 12 81696245 108495368 Mouse 27226771 Tibl14_m tibia length 14, 10 week (mouse) 12 68346774 98766259 Mouse 4142002 Tbqt3_m tibia bone quality traits 3 (mouse) Not determined 12 35285496 109936243 Mouse 4141738 Tgq23_m triglyceride QTL 23 (mouse) Not determined 72112877 106112877 Mouse 4141610 Tailaq1_m tail length adjusted QTL 1 (mouse) Not determined 80956708 113383533 Mouse 13207568 Tcq14_m total cholesterol QTL 14 (mouse) 12 11660001 97176774 Mouse 13524846 Ppiq11_m prepulse inhibition QTL 11 (mouse) 12 82666396 116666396 Mouse 1357749 Vtbt13_m vertebral trabecular bone trait 13 (mouse) Not determined 12 53132002 87132145 Mouse 10412156 Nociq3_m nociceptive sensitivity inflammatory QTL 3 (mouse) Not determined 12 86396075 114831653 Mouse 13524842 Ppiq10a_m prepulse inhibition QTL 10a (mouse) 12 77512220 111512220 Mouse 1301879 Insq10_m insulin QTL 10 (mouse) Not determined 12 83532075 117532224 Mouse 1301046 Par3_m pulmonary adenoma resistance 3 (mouse) Not determined 12 63956708 97956883 Mouse 1301492 Dbsty3_m diabesity 3 (mouse) Not determined 12 83532075 117532224 Mouse 4141335 W6q10_m weight 6 weeks QTL 10 (mouse) Not determined 80956708 113383533 Mouse 1357757 Lnopy2_m lens opacity 2 (mouse) Not determined 12 52846626 86846796 Mouse 1301689 Skull18_m skull morphology 18 (mouse) Not determined 12 73887422 107887526 Mouse 10043895 Bw20_m body weight QTL 20 (mouse) Not determined 12 62308252 96308252 Mouse 27226797 Scvln19_m sacral vertebrae length 2, 16 week (mouse) 12 62146786 99466259 Mouse 1357479 Splwt1_m spleen weight 1 (mouse) Not determined 12 41693175 90887526 Mouse 10043948 Pbft6_m percent body fat 6 (mouse) Not determined 12 61205427 95205427 Mouse 1301926 Adip6_m adiposity 6 (mouse) Not determined 12 73887422 107887526 Mouse 27226793 Feml10_m femur length 10, 5 week (mouse) 12 68346774 113363620 Mouse 27226728 Tibl20_m tibia length 20, 16 week (mouse) 12 59146786 93866774 Mouse 1301476 Pbwg12_m postnatal body weight growth 12 (mouse) Not determined 12 62040164 96040364 Mouse 4142401 Egq10_m early growth QTL 10 (mouse) Not determined 80956708 113383533 Mouse 13524849 Ppiq11a_m prepulse inhibition QTL 11a (mouse) 12 80989143 114989143 Mouse
AI834978
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 86,695,515 - 86,695,598 UniSTS GRCm38 GRCm38 5 96,319,092 - 96,319,176 UniSTS GRCm38 MGSCv37 12 88,036,465 - 88,036,548 UniSTS GRCm37 MGSCv37 5 96,748,111 - 96,748,195 UniSTS GRCm37 Celera 12 88,157,470 - 88,157,553 UniSTS Celera 5 93,658,295 - 93,658,379 UniSTS Cytogenetic Map 12 D2 UniSTS Whitehead/MRC_RH 12 817.98 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000021681 ⟹ ENSMUSP00000021681
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 86,725,474 - 86,738,865 (+) Ensembl GRCm38.p6 Ensembl 12 86,678,700 - 86,692,091 (+) Ensembl
RefSeq Acc Id:
NM_177354 ⟹ NP_796328
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 86,725,474 - 86,742,455 (+) NCBI GRCm38 12 86,678,700 - 86,695,681 (+) NCBI MGSCv37 12 88,019,650 - 88,036,631 (+) RGD Celera 12 88,121,996 - 88,155,710 (-) NCBI cM Map 12 ENTREZGENE
Sequence:
GCGGCGCGGCGCGGACCGGTGTCGAGCCGGGTGGGCGGCGGGAGGGCTGGGGACCCGGCAGGCGGCAGCGGTGGCTTCTGCTTCGCCGAGCCGGGACGCAGCGATCGGCCGATGGGCTGCACCTTCTC
hide sequence
RefSeq Acc Id:
XM_011244107 ⟹ XP_011242409
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 86,727,129 - 86,742,462 (+) NCBI GRCm38 12 86,680,345 - 86,695,688 (+) NCBI
Sequence:
AAGATGGGTTTTATTGACCTTGAAGCTAAGAAAGTAACCTACACTATTTTGTTGCTGATGAATG
hide sequence
RefSeq Acc Id:
NP_796328 ⟸ NM_177354
- UniProtKB:
E9QKT9 (UniProtKB/Swiss-Prot), Q8C394 (UniProtKB/Swiss-Prot), Q8C1W1 (UniProtKB/Swiss-Prot), A0PCF8 (UniProtKB/TrEMBL)
- Sequence:
MPGGKKVVPSGSSSASPNAAATTTAAAAAAAAAPHSGTKRLETTEGASAQRDEEPEEEGEEDLRDGGVPFFINRGGLPVDEATWERMWKHVAKIHPDGEKVALRIRGATDLPKIPIPSVPTFQPTTPV
hide sequence
RefSeq Acc Id:
XP_011242409 ⟸ XM_011244107
- Peptide Label:
isoform X1
- Sequence:
MDLAKEMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVNFGGRYGALGMSRREDLMYKPPAFRTLSELVLDYEAAYGRCWHVLKKVKLGQCVSHDPHSVEQIEWKHSVLD
hide sequence
Ensembl Acc Id:
ENSMUSP00000021681 ⟸ ENSMUST00000021681
RGD ID: 8678864 Promoter ID: EPDNEW_M17462 Type: initiation region Name: Vash1_1 Description: Mus musculus vasohibin 1 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 12 86,678,748 - 86,678,808 EPDNEW
RGD ID: 6823504 Promoter ID: MM_KWN:12232 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Lung, Spleen Transcripts: NM_177354, OTTMUST00000074391 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 12 88,019,384 - 88,019,884 (+) MPROMDB
RGD ID: 6823505 Promoter ID: MM_KWN:12233 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, Brain Transcripts: UC007OHY.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 12 88,035,081 - 88,036,097 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-05
Vash1
vasohibin 1
D930046M13Rik
RIKEN cDNA D930046M13 gene
Data merged from RGD:1609517
737654 PROVISIONAL
