No known orthologs.
Symbol:
Cmtm2a
Name:
CKLF-like MARVEL transmembrane domain containing 2A
RGD ID:
1552714
MGI Page
MGI
Description:
Enables transcription corepressor activity. Acts upstream of or within negative regulation of DNA-templated transcription and regulation of testosterone biosynthetic process. Located in cytoplasm and nucleus. Orthologous to human CMTM2 (CKLF like MARVEL transmembrane domain containing 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1700001K04Rik; 1700041N15Rik; 1700063K20Rik; AI449770; AR; ARR19; C32; chemokine-like factor super family 2A; chemokine-like factor superfamily 2-1b; chemokine-like factor superfamily member 2A; Ckl; Cklf; CKLF-like MARVEL transmembrane domain-containing protein 2A; Cklf1; CKLF3; CKLF4; CKLF5; Cklfs; Cklfsf2-1b; Cklfsf2a; UCK-1
RGD Orthologs
Alliance Orthologs
More Info
homologs ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 105,007,674 - 105,019,813 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 105,007,674 - 105,019,813 (-) Ensembl GRCm39 Ensembl GRCm38 8 104,281,042 - 104,293,181 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 104,281,042 - 104,293,181 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 106,804,942 - 106,817,081 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 107,170,171 - 107,182,303 (-) NCBI MGSCv36 mm8 Celera 8 108,512,498 - 108,524,606 (-) NCBI Celera Cytogenetic Map 8 D3 NCBI cM Map 8 53.04 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
.
Predicted Target Of
Count of predictions: 100 Count of miRNA genes: 97 Interacting mature miRNAs: 99 Transcripts: ENSMUST00000034344 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1300560 Tgl1_m triglyceride level 1 (mouse) Not determined 8 102486208 111650036 Mouse 4141435 Fbtq3_m femoral bone trait QTL 3 (mouse) Not determined 8 100965309 130127694 Mouse 11252141 Fdr2_m fat response to dietary restriction 2 (mouse) 8 98390634 130127694 Mouse 1357470 Obq16_m obesity QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1302105 Im1_m Immunoregulatory 1 (mouse) Not determined 8 99828531 130127694 Mouse 1301080 Sluc9_m susceptibility to lung cancer 9 (mouse) Not determined 8 99828531 130127694 Mouse 1558875 Eae31_m experimental allergic encephalomyelitis susceptibility 31 (mouse) Not determined 8 35109930 115563747 Mouse 1301767 Fcsa2_m femoral cross-sectional area 2 (mouse) Not determined 8 71032003 105032123 Mouse 10412234 Nhdlq14_m non-HDL QTL 14 (mouse) Not determined 8 76411976 110412125 Mouse 1301766 Desp1_m despair 1 (mouse) Not determined 8 85486208 119486373 Mouse 1301253 Skmw2_m skeletal muscle weight 2 (mouse) Not determined 8 86443553 120443701 Mouse 1301316 Dntcs1_m dental caries susceptibility 1 (mouse) Not determined 8 103443553 127781786 Mouse 4140967 Bmd39_m bone mineral density 39 (mouse) Not determined 8 32506572 117965439 Mouse 1357708 Orq1_m ovulation rate QTL 1 (mouse) Not determined 8 71740461 124622354 Mouse 1300681 Pgia22_m proteoglycan induced arthritis 22 (mouse) Not determined 8 102486208 116025457 Mouse 10755519 Wbc1_m white blood cell count 1 (mouse) 8 82345783 116345783 Mouse 27226754 Femd6_m femur midshaft diameter 6, 10 week (mouse) 8 37867154 110326632 Mouse 1301581 Char2_m P. chabaudi malaria resistance QTL 2 (mouse) Not determined 8 79808806 113809031 Mouse 1301874 Hdlq16_m HDL QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1357494 Obsty2_m obesity 2 (mouse) Not determined 8 96245241 129745061 Mouse 1301872 Cd4ts3_m CD4 T cell subset 3 (mouse) Not determined 8 72122809 106123021 Mouse 10045619 Heal14_m wound healing/regeneration 14 (mouse) Not determined 8 86443553 120443701 Mouse 1558780 Idd22_m insulin dependent diabetes susceptibility 22 (mouse) Not determined 8 71829531 105829637 Mouse 1300920 Pitm3_m prion incubation time 3 (mouse) Not determined 8 73929123 107929226 Mouse 12880431 Fgf23lq2_m FGF23 serum level QTL 2 (mouse) 8 97626632 130127694 Mouse 10755530 Wbc2_m white blood cell count 2 (mouse) 8 81819296 115819296 Mouse 1302049 Heal1_m wound healing/regeneration 1 (mouse) Not determined 8 86443553 120443701 Mouse 27226796 Scvln16_m sacral vertebrae length 2, 16 week (mouse) 8 89726628 130027694 Mouse 4142283 Imraq2_m immune response to AAV2 QTL 2 (mouse) Not determined 8 71032003 105032123 Mouse 27095912 Pglq14_m pelvic girdle length QTL 14, 16 week (mouse) 8 74126628 126826739 Mouse 4142023 W3q5_m weight 3 weeks QTL 5 (mouse) Not determined 71740461 124622354 Mouse 1301099 Cbm2_m cerebellum weight 2 (mouse) Not determined 8 79245241 113245331 Mouse 1301481 Lith11_m lithogenic gene 11 (mouse) Not determined 8 98563635 130127694 Mouse 1558890 Lith18_m lithogenic gene 18 (mouse) Not determined 8 76402145 110402251 Mouse
AI449770
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 104,281,332 - 104,281,478 UniSTS GRCm38 GRCm38 8 104,257,304 - 104,257,450 UniSTS GRCm38 MGSCv37 8 106,805,232 - 106,805,378 UniSTS GRCm37 MGSCv37 8 106,781,204 - 106,781,350 UniSTS GRCm37 Celera 8 108,512,788 - 108,512,934 UniSTS Celera 8 108,488,760 - 108,488,906 UniSTS Cytogenetic Map 8 D3 UniSTS Cytogenetic Map 8 D1 UniSTS Whitehead/MRC_RH 8 1217.16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000034344 ⟹ ENSMUSP00000034344
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 105,007,674 - 105,019,810 (-) Ensembl GRCm38.p6 Ensembl 8 104,281,042 - 104,293,178 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000212487 ⟹ ENSMUSP00000148812
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 105,017,745 - 105,019,813 (-) Ensembl GRCm38.p6 Ensembl 8 104,291,113 - 104,293,181 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000212492 ⟹ ENSMUSP00000148378
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 105,007,931 - 105,019,806 (-) Ensembl GRCm38.p6 Ensembl 8 104,281,299 - 104,293,174 (-) Ensembl
RefSeq Acc Id:
NM_027022 ⟹ NP_081298
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 105,007,674 - 105,019,813 (-) NCBI GRCm38 8 104,281,042 - 104,293,181 (-) NCBI MGSCv37 8 106,804,942 - 106,817,081 (-) RGD Celera 8 108,512,498 - 108,524,606 (-) RGD cM Map 8 ENTREZGENE
Sequence:
AGTGGTCAGTTGAGAGCCACCCTTGAACAGGTCAGGAGACACCAGGCTCTCTCTCGAGCTGGGCCTGTTCAGCGACTGCAGACAAGGCTGGGCGGTAGGAAGCTGAGAACTACCTGCTAACAACCATG GCAGCACCGATAAAGTTTCCATTTCGGCCCAGAGGAGGTCAGCCCAGAGAGGACACGACCCCAAAAAGGGGGCTTCGACGCTATCTATTGGAATTGAAAGAGAGCAATAAAGAGTTCTGGCTGTCAGG ACACGCCGTGTTCAAGCTTCTGTCTTTGGGCTGCATGATCTCTGCACTAGACTACTTTGAAACAATGCTCCCACATCCGGTCCTGATCCTGCTCATCTGTATGGAAGCGGCAATCTGCATATTCTTCA TCTTCCTTAACACCTTAGCCATCAACAGATACATTCCCTTCGTCTTCTGGCCTATGGCGGATATCTTCAACAGCCTGTTCTCCTGTGTGTTCCTTGGAGGTGGCATATACTTTGCTTTCAAGGCTAGA AGATTATTGCCAAAGCCCTACTTAACTGCTATGATCCTCATGGGCGCTGCTGCGATCTGTTCTTTCATCGACATGTTACTTCAATTCCAACACTTCAGAGGCCTTAGGTTAAGGAAGTGGTAACTGTG ACATCTATGATCTTTTTCATCGTGGGACAAGCCCCTGAACCATATATCGTCATTACTGGGTTTGAAGTCACCATTATTTTCTGTTTCGTAGTCTTGTATATGTGCAGACGTGACAAGATAATGAAATC TTTCTTTTGGCCTTTGCTTGTAAGTGATGAACTTCAACCTTAAACCTTAACTAACTTTCCTGCCTTAGGAAGACACCTTAGTCAACTACTTGAATCTCCTAAATCTTTAAGGTGATCTCTGCTCACTG CTTGGGGGATGCTCTCAGGGATTCAGGATACCCACAGAACATAAGTTCTCTTTACTCTATCTACCAGTAGGTATGGCTGACCTTTCTCTTAACTATAAATGTTATGAAATATAATCTGGTGGCCGGCC GGGGTACCTGGAGGACCCATGCCAAGCTGTGCAACTGAGAAATAAACACCATGAAACAGA
hide sequence
RefSeq Acc Id:
NP_081298 ⟸ NM_027022
- UniProtKB:
Q811V3 (UniProtKB/Swiss-Prot), Q9CVR4 (UniProtKB/Swiss-Prot), Q9DAR1 (UniProtKB/Swiss-Prot)
- Sequence:
MAAPIKFPFRPRGGQPREDTTPKRGLRRYLLELKESNKEFWLSGHAVFKLLSLGCMISALDYFETMLPHPVLILLICMEAAICIFFIFLNTLAINRYIPFVFWPMADIFNSLFSCVFLGGGIYFAFKA RRLLPKPYLTAMILMGAAAICSFIDMLLQFQHFRGLRLRKW
hide sequence
Ensembl Acc Id:
ENSMUSP00000034344 ⟸ ENSMUST00000034344
Ensembl Acc Id:
ENSMUSP00000148378 ⟸ ENSMUST00000212492
Ensembl Acc Id:
ENSMUSP00000148812 ⟸ ENSMUST00000212487
RGD ID: 8668003
Promoter ID: EPDNEW_M12032
Type: initiation region
Name: Cmtm2a_1
Description: Mus musculus CKLF-like MARVEL transmembrane domain containing2A , mRNA.
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 104,293,174 - 104,293,234 EPDNEW