Advanced Search (OLGA)

Gene: Or13d1 (olfactory receptor family 13 subfamily D member 1) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Or13d1

Name:

olfactory receptor family 13 subfamily D member 1

RGD ID:

1550400

MGI Page

MGI

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception of smell. Predicted to act upstream of or within G protein-coupled receptor signaling pathway and sensory perception of smell. Predicted to be located in membrane. Predicted to be active in plasma membrane. Is expressed in olfactory epithelium. Orthologous to human OR13D1 (olfactory receptor family 13 subfamily D member 1).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GA_x6K02T2N78B-7025964-7025020; MGC157524; MOR262; MOR262-9; olfactory receptor 270; olfactory receptor MOR262-9; Olfr270

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	52,970,629 - 52,971,567 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	52,964,547 - 52,972,474 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	52,970,629 - 52,971,567 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	52,964,547 - 52,972,474 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	52,983,501 - 52,984,439 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	52,991,729 - 52,992,667 (+)	NCBI		MGSCv36	mm8
Celera	4	52,945,421 - 52,946,359 (+)	NCBI		Celera
Cytogenetic Map	4	B2	NCBI
cM Map	4	28.57	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or13d1	Mouse	1,2-dimethylhydrazine	multiple interactions	ISO	Or13d1 (Rattus norvegicus)	6480464	[APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in decreased expression of OR13D1 mRNA	CTD	PMID:27840820
Or13d1	Mouse	4,4'-diaminodiphenylmethane	increases expression	EXP		6480464	4 and 4'-diaminodiphenylmethane results in increased expression of OR13D1 mRNA	CTD	PMID:18648102
Or13d1	Mouse	bis(2-ethylhexyl) phthalate	decreases expression	ISO	OR13D1 (Homo sapiens)	6480464	Diethylhexyl Phthalate results in decreased expression of OR13D1 mRNA	CTD	PMID:31163220
Or13d1	Mouse	bisphenol A	decreases expression	ISO	Or13d1 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of OR13D1 mRNA	CTD	PMID:25181051
Or13d1	Mouse	CGP 52608	multiple interactions	ISO	OR13D1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to OR13D1 gene]	CTD	PMID:28238834
Or13d1	Mouse	folic acid	decreases expression	EXP		6480464	Folic Acid results in decreased expression of OR13D1 mRNA	CTD	PMID:25629700
Or13d1	Mouse	valproic acid	decreases methylation	ISO	OR13D1 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of OR13D1 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or13d1	Mouse	detection of chemical stimulus involved in sensory perception of smell	involved_in	IBA	PANTHER:PTN002818000 and MGI:106182	2290270		GO_Central	GO_REF:0000033
Or13d1	Mouse	G protein-coupled receptor signaling pathway	acts_upstream_of_or_within	ISA	protein_id:CAB96148	2290270	PMID:14611657	MGI	PMID:14611657
Or13d1	Mouse	sensory perception of smell	acts_upstream_of_or_within	ISA	protein_id:CAB96148	2290270	PMID:14611657	MGI	PMID:14611657

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or13d1	Mouse	membrane	located_in	ISA	protein_id:CAB96148	2290270	PMID:14611657	MGI	PMID:14611657
Or13d1	Mouse	plasma membrane	is_active_in	IBA	PANTHER:PTN002818000 more ...	2290270		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or13d1	Mouse	olfactory receptor activity	enables	IBA	PANTHER:PTN002818000 more ...	2290270		GO_Central	GO_REF:0000033
Or13d1	Mouse	olfactory receptor activity	enables	ISA	protein_id:CAB96148	2290270	PMID:14611657	MGI	PMID:14611657

#	Reference Title	Reference Citation
1.	MGDs mouse GO annotations	MGD data from the GO Consortium
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11802173	PMID:11875048	PMID:12477932	PMID:14611657	PMID:18854508	PMID:21267068	PMID:21873635	PMID:32295537

Or13d1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	52,970,629 - 52,971,567 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	52,964,547 - 52,972,474 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	52,970,629 - 52,971,567 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	52,964,547 - 52,972,474 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	52,983,501 - 52,984,439 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	52,991,729 - 52,992,667 (+)	NCBI		MGSCv36	mm8
Celera	4	52,945,421 - 52,946,359 (+)	NCBI		Celera
Cytogenetic Map	4	B2	NCBI
cM Map	4	28.57	NCBI

OR13D1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	104,694,518 - 104,695,462 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	104,694,518 - 104,695,462 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	107,456,799 - 107,457,743 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	106,496,524 - 106,497,564 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	104,536,257 - 104,537,298	NCBI
Celera	9	77,962,003 - 77,963,043 (+)	NCBI		Celera
Cytogenetic Map	9	q31.1	NCBI
HuRef	9	77,058,749 - 77,059,789 (+)	NCBI		HuRef
CHM1_1	9	107,603,602 - 107,604,642 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	116,869,296 - 116,870,240 (+)	NCBI		T2T-CHM13v2.0

Or13d1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	72,384,695 - 72,385,633 (+)	NCBI		GRCr8
mRatBN7.2	5	67,589,306 - 67,590,244 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	67,583,530 - 67,593,557 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	69,497,351 - 69,498,289 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	71,289,311 - 71,290,249 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	71,286,175 - 71,287,113 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	69,784,806 - 69,785,744 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	69,784,806 - 69,785,744 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	73,948,759 - 73,949,697 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	70,400,310 - 70,401,248 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	70,405,422 - 70,406,361 (+)	NCBI
Celera	5	66,496,706 - 66,497,644 (+)	NCBI		Celera
Cytogenetic Map	5	q23	NCBI

OR13D3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	60,691,604 - 60,692,607 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	60,691,604 - 60,692,548 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	59,153,497 - 59,154,441 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	61,825,329 - 61,826,273 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	61,824,968 - 61,831,472 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	60,346,999 - 60,347,943 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	60,361,190 - 60,362,134 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	61,056,234 - 61,057,178 (+)	NCBI		UU_Cfam_GSD_1.0

LOC101978213
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	175,867,551 - 175,868,495 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936559	7,398,090 - 7,399,034 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100739528
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	1	246,074,926 - 246,079,677 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	275,572,686 - 275,573,624 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC101717294
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624758	6,686,601 - 6,687,545 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624758	6,686,601 - 6,687,539 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Or13d1
23 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	186
Count of miRNA genes:	90
Interacting mature miRNAs:	93
Transcripts:	ENSMUST00000095084, ENSMUST00000172257
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1301586	Stheal3_m	soft tissue heal 3 (mouse)			Not determined		4	28658442	62658566	Mouse
11532714	Sluc43_m	susceptibility to lung cancer 43 (mouse)					4	46642108	123127211	Mouse
39128211	Lwq22_m	liver weight QTL 22 (mouse)					4	17892616	88982216	Mouse
25314308	Mlh1fc1_m	MLH1 foci count 1 (mouse)					4	48500000	76918237	Mouse
1301786	Bpq3_m	blood pressure QTL 3 (mouse)			Not determined		4	42402240	76402381	Mouse
10412178	Habiir2_m	hyperoxic acute lung injury imprinted region 2 (mouse)			Not determined		4	39452126	63283678	Mouse
1300574	Im2_m	immunoregulatory 2 (mouse)			Not determined		4	28077682	62077816	Mouse
1301213	Lgth3_m	body length 3 (mouse)			Not determined		4	50100262	84100408	Mouse
4142318	Lyr2_m	lymphoma resistance 2 (mouse)			Not determined			14010457	63283678	Mouse
1301697	Sluc18_m	susceptibility to lung cancer 18 (mouse)			Not determined		4	22373448	56373612	Mouse
1357895	Ctrcts_m	cataract severity (mouse)			Not determined		4	45709925	138342753	Mouse
1357453	Kidq4_m	kidney weight QTL 4 (mouse)			Not determined		4	17892616	88982216	Mouse
1558794	Agnm1_m	autoimmune glomerulonephritis in MRL 1 (mouse)			Not determined		4	46332646	55755867	Mouse
13207572	Spir2_m	Streptococcus pneumoniae infection resistance 2 (mouse)					4	50682795	88510637	Mouse
4142047	Mvwf3_m	modifier of von Willebrand factor 3 (mouse)			Not determined			14010457	117072206	Mouse
11567249	Elorr3_m	ethanol induced loss of righting response 3 (mouse)					4	3722677	156268235	Mouse
1357877	Synch1_m	synechia 1 (mouse)			Not determined		4	28709925	62710107	Mouse
10449022	Aanq1_m	aristolochic acid nephrotoxicity QTL 1 (mouse)					4	46603826	80603826	Mouse
1300977	Mopkd1_m	modifier of polycystic kidney disease progression 1 (mouse)			Not determined		4	36550839	70550967	Mouse
1301941	Mmtg1_m	modifier of mammary tumor growth 1 (mouse)			Not determined		4	45658442	83099157	Mouse
4141911	W6q15_m	weight 6 weeks QTL 15 (mouse)			Not determined			17892616	88982216	Mouse
1302075	Bdln6_m	body length 6 (mouse)			Not determined		4	22373448	56373612	Mouse
12879977	Bod2_m	bone length and organs 2 (mouse)					4	46283531	80283678	Mouse
1301437	Scon1_m	sucrose consumption 1 (mouse)			Not determined		4	22373448	56373612	Mouse
10043880	Adip23_m	adiposity 23 (mouse)			Not determined		4	46283531	80283678	Mouse
1300769	Pcyts2_m	plasmacytoma susceptibility 2 (mouse)			Not determined		4	22111944	56112145	Mouse
1301792	Hdlq10_m	HDL QTL 10 (mouse)			Not determined		4	35859707	69859853	Mouse
1558948	Ath8_m	atherosclerosis 8 (mouse)			Not determined		4	45658442	105156995	Mouse
1301990	Arvm1_m	autoimmune renal vasculitis 1 (mouse)			Not determined		4	29332646	63332776	Mouse
1300966	Pabr2_m	plasma apolipoprotein B (human) regulator 2 (mouse)			Not determined		4	46332646	105801860	Mouse
1302116	Bbaa1_m	B.burgdorferi-associated arthritis 1 (mouse)			Not determined		4	38250930	72251078	Mouse
1301995	Lprm1_m	lymphoproliferation modifier 1 (mouse)			Not determined		4	50100262	84100408	Mouse
1302058	Hrtfm3_m	heart failure modifier 3 (mouse)			Not determined		4	22111944	56112145	Mouse
26884449	Sklq2_m	skull length QTL 2, 5 week (mouse)					4	36700000	128993793	Mouse
27226724	Tibw2_m	tibia width 2, proximal, 10 week (mouse)					4	43000000	108357197	Mouse
11532688	Mh_m	modifier of hemostasis (mouse)					4	48304775	82304775	Mouse

UniSTS:494936

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	4	52,970,598 - 52,971,591	UniSTS	GRCm38
MGSCv37	4	52,983,470 - 52,984,463	UniSTS	GRCm37
Celera	4	52,945,390 - 52,946,383	UniSTS
Cytogenetic Map	4	B2-C2	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_146607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF287263	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL772397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY073490	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY317363	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC127971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000095084 ⟹ ENSMUSP00000092699

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	52,968,055 - 52,972,474 (+)	Ensembl
GRCm38.p6 Ensembl	4	52,968,055 - 52,972,474 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000172257 ⟹ ENSMUSP00000133100

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	52,970,629 - 52,971,567 (+)	Ensembl
GRCm38.p6 Ensembl	4	52,970,629 - 52,971,567 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000215010 ⟹ ENSMUSP00000150409

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	52,964,547 - 52,972,474 (+)	Ensembl
GRCm38.p6 Ensembl	4	52,964,547 - 52,972,474 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000215127 ⟹ ENSMUSP00000150038

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	52,964,564 - 52,972,474 (+)	Ensembl
GRCm38.p6 Ensembl	4	52,964,564 - 52,972,474 (+)	Ensembl

RefSeq Acc Id:

NM_146607 ⟹ NP_666818

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	4	52,970,629 - 52,971,567 (+)	NCBI
GRCm38	4	52,970,629 - 52,971,567 (+)	ENTREZGENE
MGSCv37	4	52,983,501 - 52,984,439 (+)	RGD
Celera	4	52,945,421 - 52,946,359 (+)	RGD
cM Map	4		ENTREZGENE

Sequence:

show sequence

ATGGGAAATTACTCTGCAGTGACAGAATTCTTTCTCGTGGGACTTTCCCAGTATCCAGAACTCCAGCTTTTCCTATTTGTGCTCTGCCTCATCATGTACTTGATAATCCTCCTGGGAAACAGTCTGCT
CATTATCATTAGTATCCTGGATTCTCGGCTCCACACCCCCATGTACTTTTTTCTTGGGAATCTCTCTTTTTTGGACATCTGTTACACATCCTCATCCATTCCTCAAATGCTCATCATGTTTATGTCAG
CGAGAAAATCCATCTCCTTCCTTGGTTGTGCTCTACAAATGGTTATCTCCCTTGGCTTGGGTTCTACAGAGTGTGTCCTCCTGGCTGTGATGGCCTATGATAGGTATGCAGCCATTTGCAATCCACTG
AGGTACCCTATAATCATGAACAAAGTATTATATGTGCACATGGCTGTGTGGTCCTGGGTCATAGGCTGTCTGAATTCTCTAGTGCAAACAGTCTTGACAATGGTGTTACCTTTCTGTGGCAACAATGT
CATTGATCACCTTACCTGTGAGATCCTGGCTCTTCTTAAACTTGTATGCTCAGATATCACCATGAATGTGCTTATCATGACAGTGGCCAGTATTGTTTTGTTGATGATCCCTCTGATGTTAATTTTTG
TGTCCTATATTTTTATCCTTTCTTCCATTCTGAGAATTAATTCTGCGGAAGGAAGGAAGAAAGCCTTTTCAACCTGTTCAGCCCACCTAACCGTGGTCATCTTATTCTATGGTTCAGCCCTTTTTATG
TACATGAAACCCAAGTCAAAGTACACCAAAGCATCTGATGAAATCATTGGACTGTCTTATGGAGTTGTGACGCCAATGTTGAATCCCATCATCTACAGCTTGAGGAATAAGGAGGTCAAAGAAGCCGT
GAAGAAAATTTTGAGCAAACGTTTGTACCTGCGGAAAATCTGA

hide sequence


Protein RefSeqs	NP_666818	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI27972	(Get FASTA)	NCBI Sequence Viewer
	AAL61153	(Get FASTA)	NCBI Sequence Viewer
	AAP70823	(Get FASTA)	NCBI Sequence Viewer
	EDL02290	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000092699.2
	ENSMUSP00000133100
	ENSMUSP00000133100.2
	ENSMUSP00000150038.2
	ENSMUSP00000150409.2

RefSeq Acc Id:

NP_666818 ⟸ NM_146607

- UniProtKB:

Q8VFN0 (UniProtKB/TrEMBL), Q7TS19 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGNYSAVTEFFLVGLSQYPELQLFLFVLCLIMYLIILLGNSLLIIISILDSRLHTPMYFFLGNLSFLDICYTSSSIPQMLIMFMSARKSISFLGCALQMVISLGLGSTECVLLAVMAYDRYAAICNPL
RYPIIMNKVLYVHMAVWSWVIGCLNSLVQTVLTMVLPFCGNNVIDHLTCEILALLKLVCSDITMNVLIMTVASIVLLMIPLMLIFVSYIFILSSILRINSAEGRKKAFSTCSAHLTVVILFYGSALFM
YMKPKSKYTKASDEIIGLSYGVVTPMLNPIIYSLRNKEVKEAVKKILSKRLYLRKI

hide sequence

Ensembl Acc Id:

ENSMUSP00000133100 ⟸ ENSMUST00000172257

Ensembl Acc Id:

ENSMUSP00000092699 ⟸ ENSMUST00000095084

Ensembl Acc Id:

ENSMUSP00000150038 ⟸ ENSMUST00000215127

Ensembl Acc Id:

ENSMUSP00000150409 ⟸ ENSMUST00000215010

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q7TS19-F1-model_v2	AlphaFold	Q7TS19	1-314	view protein structure

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000070983	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000095084.3	UniProtKB/TrEMBL
	ENSMUST00000172257	ENTREZGENE
	ENSMUST00000172257.2	UniProtKB/TrEMBL
	ENSMUST00000215010.2	UniProtKB/TrEMBL
	ENSMUST00000215127.2	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
KEGG Report	mmu:258600	UniProtKB/TrEMBL
MGD	MGI:3030104	ENTREZGENE
NCBI Gene	258600	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or13d1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	Q7TS19	ENTREZGENE, UniProtKB/TrEMBL
	Q8VFN0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-05-23	Or13d1	olfactory receptor family 13 subfamily D member 1	Olfr270	olfactory receptor 270	Symbol and/or name updated	27372883	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message