OR8U1 (olfactory receptor family 8 subfamily U member 1)

Advanced Search (OLGA)

Gene: OR8U1 (olfactory receptor family 8 subfamily U member 1) Homo sapiens

Analyze

Symbol:

OR8U1

Name:

olfactory receptor family 8 subfamily U member 1

RGD ID:

1353375

HGNC Page

HGNC:19611

Description:

Predicted to enable odorant binding activity and olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and sensory perception of smell. Predicted to be located in plasma membrane.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

olfactory receptor 8U1; olfactory receptor, family 8, subfamily U, member 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	56,375,624 - 56,376,553 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	56,375,624 - 56,376,553 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	56,143,100 - 56,144,029 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	55,899,676 - 55,900,635 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	55,899,675 - 55,900,605	NCBI
Cytogenetic Map	11	q12.1	NCBI
CHM1_1	11	56,009,388 - 56,010,317 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	56,313,539 - 56,314,468 (+)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

intellectual disability (IAGP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

aflatoxin B1 (EXP)

benzo[a]pyrene (EXP)

bisphenol A (ISO)

copper(II) sulfate (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IBA,IEA)

sensory perception of smell (IBA,IEA)

Cellular Component

membrane (IEA)

plasma membrane (IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

odorant binding (IBA)

olfactory receptor activity (IBA,IEA)

Phenotype Annotations Click to see Annotation Detail View

Human Phenotype

Intellectual disability (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:17803354	PMID:21873635	PMID:28625976

Genomics

Comparative Map Data

OR8U1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	56,375,624 - 56,376,553 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	56,375,624 - 56,376,553 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	56,143,100 - 56,144,029 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	55,899,676 - 55,900,635 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	55,899,675 - 55,900,605	NCBI
Cytogenetic Map	11	q12.1	NCBI
CHM1_1	11	56,009,388 - 56,010,317 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	56,313,539 - 56,314,468 (+)	NCBI		T2T-CHM13v2.0

Or8u9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	86,001,215 - 86,002,159 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	85,998,933 - 86,008,164 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	86,170,871 - 86,171,815 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	86,168,589 - 86,177,820 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	86,011,028 - 86,011,972 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	85,971,710 - 85,972,654 (-)	NCBI		MGSCv36	mm8
Celera	2	87,744,504 - 87,745,448 (-)	NCBI		Celera
Cytogenetic Map	2	D	NCBI
cM Map	2	49.74	NCBI

Or8u9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	91,582,049 - 91,582,993 (-)	NCBI		GRCr8
mRatBN7.2	3	71,175,389 - 71,176,333 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	71,175,389 - 71,176,333 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	74,560,325 - 74,561,269 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	83,158,863 - 83,159,807 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	80,942,930 - 80,943,874 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	73,492,677 - 73,493,621 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	73,492,677 - 73,493,621 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	80,061,898 - 80,062,842 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	69,347,032 - 69,347,976 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	69,243,403 - 69,244,348 (-)	NCBI
Celera	3	70,505,531 - 70,506,475 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

OR8U9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	39,527,363 - 39,528,322 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	39,527,363 - 39,528,322 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	39,073,087 - 39,074,792 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	40,204,856 - 40,206,561 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	40,204,856 - 40,205,815 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	39,809,444 - 39,811,149 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	39,376,725 - 39,378,430 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	39,959,784 - 39,961,489 (-)	NCBI		UU_Cfam_GSD_1.0

LOC100522603
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa10.2	2	159,030,162 - 159,031,103 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103235665
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	16,563,980 - 16,565,819 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	16,564,135 - 16,565,094 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	113,883,001 - 113,883,960 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in OR8U1
30 total Variants

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 11q11-12.1(chr11:55445689-57114783)x1	copy number loss	See cases [RCV000050913]	Chr11:55445689..57114783 [GRCh38] Chr11:55213165..56882257 [GRCh37] Chr11:54969741..56638833 [NCBI36] Chr11:11q11-12.1	benign
NM_001005204.1(OR8U1):c.442C>T (p.Pro148Ser)	single nucleotide variant	Malignant melanoma [RCV000069491]	Chr11:56376065 [GRCh38] Chr11:56143541 [GRCh37] Chr11:55900117 [NCBI36] Chr11:11q12.1	not provided
Single allele	deletion	Intellectual disability [RCV001293382]	Chr11:118359328..118372573 [GRCh37] Chr11:11p15.3-q23.3	pathogenic
GRCh38/hg38 11q12.1(chr11:56149822-56770518)x3	copy number gain	See cases [RCV000134767]	Chr11:56149822..56770518 [GRCh38] Chr11:55917298..56537994 [GRCh37] Chr11:55673874..56294570 [NCBI36] Chr11:11q12.1	benign
GRCh38/hg38 11q11-12.1(chr11:55316535-57539457)x3	copy number gain	See cases [RCV000141200]	Chr11:55316535..57539457 [GRCh38] Chr11:55084011..57306930 [GRCh37] Chr11:54840587..57063506 [NCBI36] Chr11:11q11-12.1	uncertain significance
GRCh38/hg38 11q11-12.1(chr11:55319519-58998777)x3	copy number gain	See cases [RCV000142757]	Chr11:55319519..58998777 [GRCh38] Chr11:55086995..58766250 [GRCh37] Chr11:54843571..58522826 [NCBI36] Chr11:11q11-12.1	pathogenic
GRCh37/hg19 11p15.5-q25(chr11:230616-134938470)	copy number gain	See cases [RCV000511729]	Chr11:230616..134938470 [GRCh37] Chr11:11p15.5-q25	pathogenic
GRCh37/hg19 11p15.5-q25(chr11:230616-134938470)x3	copy number gain	See cases [RCV000510881]	Chr11:230616..134938470 [GRCh37] Chr11:11p15.5-q25	pathogenic
NM_001005204.1(OR8U1):c.812A>G (p.Asp271Gly)	single nucleotide variant	not specified [RCV004305975]	Chr11:56376435 [GRCh38] Chr11:56143911 [GRCh37] Chr11:11q12.1	uncertain significance
GRCh37/hg19 11p11.12-q12.1(chr11:51183548-56977098)x3	copy number gain	See cases [RCV000512524]	Chr11:51183548..56977098 [GRCh37] Chr11:11p11.12-q12.1	uncertain significance
GRCh37/hg19 11p11.12-q12.1(chr11:49313405-59008426)x3	copy number gain	not provided [RCV000683370]	Chr11:49313405..59008426 [GRCh37] Chr11:11p11.12-q12.1	uncertain significance
GRCh37/hg19 11p15.5-q25(chr11:198510-134934063)x3	copy number gain	not provided [RCV000737348]	Chr11:198510..134934063 [GRCh37] Chr11:11p15.5-q25	pathogenic
GRCh37/hg19 11p15.5-q25(chr11:70864-134938470)x3	copy number gain	not provided [RCV000749874]	Chr11:70864..134938470 [GRCh37] Chr11:11p15.5-q25	pathogenic
Single allele	duplication	not provided [RCV000844966]	Chr11:55033164..57518726 [GRCh37] Chr11:11q11-12.1	not provided
GRCh37/hg19 11p11.12-q12.1(chr11:51164494-56879839)x3	copy number gain	not provided [RCV001827812]	Chr11:51164494..56879839 [GRCh37] Chr11:11p11.12-q12.1	uncertain significance
GRCh37/hg19 11p11.2-q12.2(chr11:51581311-54891247)x3	copy number gain	See cases [RCV002286338]	Chr11:51581311..54891247 [GRCh37] Chr11:11p11.2-q12.2	pathogenic
GRCh37/hg19 11p13-q25(chr11:32799481-134938470)x3	copy number gain	MISSED ABORTION [RCV002282973]	Chr11:32799481..134938470 [GRCh37] Chr11:11p13-q25	pathogenic
NM_001005204.1(OR8U1):c.233C>T (p.Thr78Ile)	single nucleotide variant	not specified [RCV004317443]	Chr11:56375856 [GRCh38] Chr11:56143332 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.641T>C (p.Val214Ala)	single nucleotide variant	not specified [RCV004126630]	Chr11:56376264 [GRCh38] Chr11:56143740 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.292G>A (p.Ala98Thr)	single nucleotide variant	not specified [RCV004216183]	Chr11:56375915 [GRCh38] Chr11:56143391 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.481A>G (p.Ile161Val)	single nucleotide variant	not specified [RCV004195002]	Chr11:56376104 [GRCh38] Chr11:56143580 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.529T>C (p.Phe177Leu)	single nucleotide variant	not specified [RCV004088714]	Chr11:56376152 [GRCh38] Chr11:56143628 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.152C>T (p.Ala51Val)	single nucleotide variant	not specified [RCV004144867]	Chr11:56375775 [GRCh38] Chr11:56143251 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.854T>G (p.Leu285Trp)	single nucleotide variant	not specified [RCV004107804]	Chr11:56376477 [GRCh38] Chr11:56143953 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.408G>C (p.Met136Ile)	single nucleotide variant	not specified [RCV004204805]	Chr11:56376031 [GRCh38] Chr11:56143507 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.461T>C (p.Leu154Pro)	single nucleotide variant	not specified [RCV004193949]	Chr11:56376084 [GRCh38] Chr11:56143560 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.628T>G (p.Ser210Ala)	single nucleotide variant	not specified [RCV004224288]	Chr11:56376251 [GRCh38] Chr11:56143727 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.293C>A (p.Ala98Asp)	single nucleotide variant	not specified [RCV004210152]	Chr11:56375916 [GRCh38] Chr11:56143392 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.844A>C (p.Ile282Leu)	single nucleotide variant	not specified [RCV004239275]	Chr11:56376467 [GRCh38] Chr11:56143943 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.430C>T (p.Leu144Phe)	single nucleotide variant	not specified [RCV004131668]	Chr11:56376053 [GRCh38] Chr11:56143529 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.578G>A (p.Arg193His)	single nucleotide variant	not specified [RCV004256599]	Chr11:56376201 [GRCh38] Chr11:56143677 [GRCh37] Chr11:11q12.1	likely benign
NM_001005204.1(OR8U1):c.166A>G (p.Asn56Asp)	single nucleotide variant	not specified [RCV004343309]	Chr11:56375789 [GRCh38] Chr11:56143265 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.544A>C (p.Met182Leu)	single nucleotide variant	not specified [RCV004363558]	Chr11:56376167 [GRCh38] Chr11:56143643 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.585A>T (p.Lys195Asn)	single nucleotide variant	not specified [RCV004363677]	Chr11:56376208 [GRCh38] Chr11:56143684 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.829T>G (p.Phe277Val)	single nucleotide variant	not specified [RCV004357654]	Chr11:56376452 [GRCh38] Chr11:56143928 [GRCh37] Chr11:11q12.1	uncertain significance
GRCh37/hg19 11p11.12-q13.1(chr11:50398499-63924462)x3	copy number gain	not specified [RCV003986918]	Chr11:50398499..63924462 [GRCh37] Chr11:11p11.12-q13.1	likely pathogenic
NM_001005204.1(OR8U1):c.716C>T (p.Ser239Leu)	single nucleotide variant	not specified [RCV004502220]	Chr11:56376339 [GRCh38] Chr11:56143815 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.181T>G (p.Phe61Val)	single nucleotide variant	not specified [RCV004502214]	Chr11:56375804 [GRCh38] Chr11:56143280 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.541G>A (p.Asp181Asn)	single nucleotide variant	not specified [RCV004502219]	Chr11:56376164 [GRCh38] Chr11:56143640 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.760A>G (p.Thr254Ala)	single nucleotide variant	not specified [RCV004502221]	Chr11:56376383 [GRCh38] Chr11:56143859 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.200C>T (p.Ala67Val)	single nucleotide variant	not specified [RCV004502216]	Chr11:56375823 [GRCh38] Chr11:56143299 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.20C>G (p.Thr7Ser)	single nucleotide variant	not specified [RCV004502217]	Chr11:56375643 [GRCh38] Chr11:56143119 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.245T>C (p.Leu82Pro)	single nucleotide variant	not specified [RCV004502218]	Chr11:56375868 [GRCh38] Chr11:56143344 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.139C>A (p.Leu47Ile)	single nucleotide variant	not specified [RCV004502213]	Chr11:56375762 [GRCh38] Chr11:56143238 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.80T>G (p.Leu27Arg)	single nucleotide variant	not specified [RCV004502222]	Chr11:56375703 [GRCh38] Chr11:56143179 [GRCh37] Chr11:11q12.1	uncertain significance
NM_001005204.1(OR8U1):c.100A>G (p.Ile34Val)	single nucleotide variant	not specified [RCV004641632]	Chr11:56375723 [GRCh38] Chr11:56143199 [GRCh37] Chr11:11q12.1	uncertain significance

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	220
Count of miRNA genes:	187
Interacting mature miRNAs:	197
Transcripts:	ENST00000302270
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCh38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
407345642	GWAS994618_H	high density lipoprotein cholesterol measurement QTL GWAS994618 (human)		2e-14	high density lipoprotein cholesterol measurement	blood high density lipoprotein cholesterol level (CMO:0000052)	11	56376239	56376240	Human

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system
15	65	78	51	129	31	42	12	48	9	49	175	151	99	17	192	24	3

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001005204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB065603	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AP002512	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068267	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KP290309	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000302270 ⟹ ENSP00000304188

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	11	56,375,624 - 56,376,553 (+)	Ensembl

RefSeq Acc Id:

NM_001005204 ⟹ NP_001005204

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	11	56,375,624 - 56,376,553 (+)	NCBI
GRCh37	11	56,143,100 - 56,144,029 (+)	RGD
Build 36	11	55,899,676 - 55,900,635 (+)	NCBI Archive
CHM1_1	11	56,009,388 - 56,010,317 (+)	NCBI
T2T-CHM13v2.0	11	56,313,539 - 56,314,468 (+)	NCBI

Sequence:

show sequence

ATGGCTCACATCAATTGCACCCAGGCGACAGAGTTTATTCTTGTGGGCCTCACAGACCATCAGG
AGTTGAAGATGCCCCTCTTTGTGCTATTCTTATCCATCTACCTCTTCACAGTGGTAGGCAACTT
GGGTTTGATCCTACTCATTAGAGCGGATACAAGTCTCAACACACCAATGTACTTCTTTCTTAGC
AACCTAGCTTTTGTGGATTTCTGTTACTCTTCTGTCATTACACCCAAAATGCTTGGGAATTTCT
TGTACAAACAAAATGTTATATCCTTTGATGCATGTGCTACTCAACTGGGCTGCTTTCTCACCTT
CATGATATCAGAATCCTTGCTACTGGCTTCCATGGCCTATGACCGATATGTGGCCATTTGTAAC
CCTCTATTGTATATGGTTGTAATGACTCCAGGAATCTGCATTCAACTTGTAGCAGTTCCTTATA
GCTATAGCTTCCTAATGGCACTATTTCACACCATCCTCACCTTCCGCCTCTCCTATTGCCACTC
CAACATTGTCAACCATTTCTATTGTGATGACATGCCTCTCCTCAGGCTAACTTGCTCAGACACT
CGCTTCAAACAGCTCTGGATCTTTGCCTGTGCTGGTATCATGTTCATTTCCTCCCTTCTGATTG
TCTTTGTCTCCTACATGTTCATCATTTCTGCCATCCTGAGGATGCATTCAGCTGAGGGAAGACA
GAAGGCTTTCTCGACGTGTGGCTCTCACATGCTGGCAGTCACCATATTCTATGGGACCCTCATT
TTTATGTACTTACAGCCTAGCTCTAGCCATGCCCTGGACACAGACAAGATGGCCTCTGTCTTCT
ACACAGTGATCATTCCCATGTTGAATCCCTTAATCTATAGCCTCCAGAATAAGGAGGTGAAAGA
AGCTCTGAAGAAAATCATTATCAATAAAAACTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001005204	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ALI87487	(Get FASTA)	NCBI Sequence Viewer
	BAC05831	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000304188
	ENSP00000304188.1
	ENSP00000517450.1
GenBank Protein	Q8NH10	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001005204 ⟸ NM_001005204

- UniProtKB:

Q8NH10 (UniProtKB/Swiss-Prot), A0A126GVR7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMYFFLS
NLAFVDFCYSSVITPKMLGNFLYKQNVISFDACATQLGCFLTFMISESLLLASMAYDRYVAICN
PLLYMVVMTPGICIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIVNHFYCDDMPLLRLTCSDT
RFKQLWIFACAGIMFISSLLIVFVSYMFIISAILRMHSAEGRQKAFSTCGSHMLAVTIFYGTLI
FMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEALKKIIINKN

hide sequence

Ensembl Acc Id:

ENSP00000304188 ⟸ ENST00000302270

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8NH10-F1-model_v2	AlphaFold	Q8NH10	1-309	view protein structure

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:19611	AgrOrtholog
COSMIC	OR8U1	COSMIC
Ensembl Genes	ENSG00000172199	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSG00000291846	UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000302270	ENTREZGENE
	ENST00000302270.1	UniProtKB/Swiss-Prot
	ENST00000708996.1	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GTEx	ENSG00000172199	GTEx
	ENSG00000291846	GTEx
HGNC ID	HGNC:19611	ENTREZGENE
Human Proteome Map	OR8U1	Human Proteome Map
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	hsa:219417	UniProtKB/Swiss-Prot
NCBI Gene	OR8U1	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OLFACTORY RECEPTOR 8U1-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	PA134970669	PharmGKB
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A126GVR7	ENTREZGENE, UniProtKB/TrEMBL
	OR8U1_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-15	OR8U1	olfactory receptor family 8 subfamily U member 1	OR8U1	olfactory receptor, family 8, subfamily U, member 1	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Human Phenotype Annotations - ClinVar

Send us a Message

Imported Disease Annotations - ClinVar

Imported Human Phenotype Annotations - ClinVar