Symbol:
HOXD1
Name:
homeobox D1
RGD ID:
1319375
HGNC Page
HGNC:5132
Description:
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within embryonic skeletal system development; neuron differentiation; and sensory perception of pain. Located in nucleoplasm.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
homeo box 4G; homeo box D1; homeobox protein Hox-D1; homeobox protein Hox-GG; Hox-4.7; HOX4; HOX4G
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Hoxd1 (homeobox D1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Hoxd1 (homeo box D1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Hoxd1 (homeobox D1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
HOXD1 (homeobox D1) NCBI
Ortholog
Canis lupus familiaris (dog):
HOXD1 (homeobox D1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hoxd1 (homeobox D1) NCBI
Ortholog
Sus scrofa (pig):
HOXD1 (homeobox D1) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
HOXD1 (homeobox D1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Hoxd1 (homeobox D1) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Hoxd1 (homeo box D1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Hoxd1 (homeobox D1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
hoxc1a (homeobox C1a)
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
ceh-13
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
lab
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
hoxd1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
hoxd1.L
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
hoxd1.S
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 176,188,668 - 176,190,907 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 176,188,668 - 176,190,907 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 177,053,396 - 177,055,635 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 176,761,553 - 176,763,881 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 176,878,813 - 176,881,142 NCBI Celera 2 170,662,486 - 170,664,814 (+) NCBI Celera Cytogenetic Map 2 q31.1 NCBI HuRef 2 168,930,260 - 168,932,588 (+) NCBI HuRef CHM1_1 2 177,059,181 - 177,061,509 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 176,676,799 - 176,679,038 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
HOXD1 Human 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Hoxd1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 HOXD1 Human 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Hoxd1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 HOXD1 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hoxd1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HOXD1 mRNA CTD PMID:24058054 HOXD1 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HOXD1 mRNA CTD PMID:20106945 and PMID:21632981 HOXD1 Human 3,3',5,5'-tetrabromobisphenol A increases expression EXP 6480464 tetrabromobisphenol A results in increased expression of HOXD1 mRNA CTD PMID:33476716 HOXD1 Human 5-fluorouracil decreases expression EXP 6480464 Fluorouracil results in decreased expression of HOXD1 mRNA CTD PMID:24737281 HOXD1 Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of HOXD1 gene CTD PMID:27153756 HOXD1 Human all-trans-retinoic acid increases expression ISO Hoxd1 (Mus musculus) 6480464 Tretinoin results in increased expression of HOXD1 mRNA CTD PMID:19897914 HOXD1 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of HOXD1 mRNA CTD PMID:21934132 and PMID:23724009 HOXD1 Human amitriptyline decreases expression ISO Hoxd1 (Rattus norvegicus) 6480464 Amitriptyline results in decreased expression of HOXD1 mRNA CTD PMID:22341215 HOXD1 Human ampicillin increases expression EXP 6480464 Ampicillin results in increased expression of HOXD1 mRNA CTD PMID:21632981 HOXD1 Human arsane affects methylation EXP 6480464 Arsenic affects the methylation of HOXD1 gene CTD PMID:25304211 HOXD1 Human arsenic atom affects methylation EXP 6480464 Arsenic affects the methylation of HOXD1 gene CTD PMID:25304211 HOXD1 Human arsenite(3-) increases methylation EXP 6480464 arsenite results in increased methylation of HOXD1 promoter CTD PMID:23974009 HOXD1 Human azathioprine decreases expression EXP 6480464 Azathioprine results in decreased expression of HOXD1 mRNA CTD PMID:22623647 HOXD1 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of HOXD1 mRNA CTD PMID:21632981 HOXD1 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of HOXD1 promoter CTD PMID:27901495 HOXD1 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of HOXD1 exon CTD PMID:27901495 HOXD1 Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of HOXD1 mRNA CTD PMID:26238291 HOXD1 Human benzo[a]pyrene diol epoxide I increases expression EXP 6480464 7 more ... CTD PMID:26238291 HOXD1 Human bisphenol A increases expression ISO Hoxd1 (Mus musculus) 6480464 bisphenol A results in increased expression of HOXD1 mRNA CTD PMID:24465770 HOXD1 Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of HOXD1 mRNA CTD PMID:30903817 HOXD1 Human bisphenol A affects methylation ISO Hoxd1 (Mus musculus) 6480464 bisphenol A affects the methylation of HOXD1 promoter CTD PMID:27334623 HOXD1 Human bisphenol A decreases expression ISO Hoxd1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of HOXD1 mRNA CTD PMID:25181051 HOXD1 Human butanal increases expression EXP 6480464 butyraldehyde results in increased expression of HOXD1 mRNA CTD PMID:26079696 HOXD1 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to HOXD1 gene] CTD PMID:28238834 HOXD1 Human copper atom increases expression ISO Hoxd1 (Rattus norvegicus) 6480464 Copper deficiency results in increased expression of HOXD1 mRNA CTD PMID:26033743 HOXD1 Human copper atom multiple interactions EXP 6480464 [Disulfiram binds to Copper] which results in decreased expression of HOXD1 mRNA CTD PMID:24690739 HOXD1 Human copper(0) increases expression ISO Hoxd1 (Rattus norvegicus) 6480464 Copper deficiency results in increased expression of HOXD1 mRNA CTD PMID:26033743 HOXD1 Human copper(0) multiple interactions EXP 6480464 [Disulfiram binds to Copper] which results in decreased expression of HOXD1 mRNA CTD PMID:24690739 HOXD1 Human copper(II) sulfate decreases expression EXP 6480464 Copper Sulfate results in decreased expression of HOXD1 mRNA CTD PMID:19549813 HOXD1 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of HOXD1 mRNA CTD PMID:20106945 more ... HOXD1 Human dicrotophos increases expression EXP 6480464 dicrotophos results in increased expression of HOXD1 mRNA CTD PMID:28302478 HOXD1 Human disulfiram multiple interactions EXP 6480464 [Disulfiram binds to Copper] which results in decreased expression of HOXD1 mRNA CTD PMID:24690739 HOXD1 Human entinostat increases expression EXP 6480464 entinostat results in increased expression of HOXD1 mRNA CTD PMID:27188386 HOXD1 Human ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of HOXD1 mRNA CTD PMID:28986285 HOXD1 Human FR900359 decreases phosphorylation EXP 6480464 FR900359 results in decreased phosphorylation of HOXD1 protein CTD PMID:37730182 HOXD1 Human gentamycin increases expression ISO Hoxd1 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of HOXD1 mRNA CTD PMID:33387578 HOXD1 Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of HOXD1 mRNA CTD PMID:23410634 HOXD1 Human indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of HOXD1 mRNA CTD PMID:24737281 HOXD1 Human iron dichloride decreases expression EXP 6480464 ferrous chloride results in decreased expression of HOXD1 mRNA CTD PMID:35984750 HOXD1 Human leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of HOXD1 mRNA CTD PMID:28988120 HOXD1 Human melphalan increases expression EXP 6480464 Melphalan results in increased expression of HOXD1 mRNA CTD PMID:22363485 HOXD1 Human menadione affects expression EXP 6480464 Vitamin K 3 affects the expression of HOXD1 mRNA CTD PMID:23410634 HOXD1 Human methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of HOXD1 mRNA CTD PMID:28001369 HOXD1 Human nickel atom multiple interactions EXP 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of HOXD1 mRNA] CTD PMID:14575637 HOXD1 Human nickel atom affects expression EXP 6480464 Nickel affects the expression of HOXD1 mRNA CTD PMID:14575637 HOXD1 Human paracetamol increases expression ISO Hoxd1 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of HOXD1 mRNA CTD PMID:33387578 HOXD1 Human PCB138 multiple interactions ISO Hoxd1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 HOXD1 Human pentanal increases expression EXP 6480464 pentanal results in increased expression of HOXD1 mRNA CTD PMID:26079696 HOXD1 Human propanal increases expression EXP 6480464 propionaldehyde results in increased expression of HOXD1 mRNA CTD PMID:26079696 HOXD1 Human quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of HOXD1 mRNA CTD PMID:21632981 HOXD1 Human resorcinol increases expression EXP 6480464 resorcinol results in increased expression of HOXD1 mRNA CTD PMID:22623647 HOXD1 Human resveratrol multiple interactions EXP 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of HOXD1 mRNA CTD PMID:23557933 HOXD1 Human silicon dioxide decreases expression EXP 6480464 Silicon Dioxide analog results in decreased expression of HOXD1 mRNA CTD PMID:25895662 HOXD1 Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of HOXD1 mRNA CTD PMID:23806026 HOXD1 Human tert-butyl hydroperoxide affects expression EXP 6480464 tert-Butylhydroperoxide affects the expression of HOXD1 mRNA CTD PMID:23410634 HOXD1 Human titanium dioxide decreases methylation ISO Hoxd1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of HOXD1 gene and titanium dioxide results in decreased methylation of HOXD1 promoter CTD PMID:35295148 HOXD1 Human titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of HOXD1 mRNA CTD PMID:34973136 HOXD1 Human titanium dioxide increases methylation ISO Hoxd1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of HOXD1 gene and titanium dioxide results in increased methylation of HOXD1 promoter CTD PMID:35295148 HOXD1 Human trichloroethene increases expression ISO Hoxd1 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of HOXD1 mRNA CTD PMID:33387578 HOXD1 Human trichostatin A multiple interactions EXP 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of HOXD1 mRNA] CTD PMID:14575637 HOXD1 Human tunicamycin decreases expression EXP 6480464 Tunicamycin results in decreased expression of HOXD1 mRNA CTD PMID:29453283 HOXD1 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of HOXD1 mRNA CTD PMID:25979313 HOXD1 Human zinc sulfate decreases expression EXP 6480464 Zinc Sulfate results in decreased expression of HOXD1 mRNA CTD PMID:12756304
2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',5,5'-tetrabromobisphenol A (EXP) 5-fluorouracil (EXP) aflatoxin B1 (EXP) all-trans-retinoic acid (EXP,ISO) amitriptyline (ISO) ampicillin (EXP) arsane (EXP) arsenic atom (EXP) arsenite(3-) (EXP) azathioprine (EXP) benzo[a]pyrene (EXP) benzo[a]pyrene diol epoxide I (EXP) bisphenol A (EXP,ISO) butanal (EXP) CGP 52608 (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (EXP) cyclosporin A (EXP) dicrotophos (EXP) disulfiram (EXP) entinostat (EXP) ethanol (EXP) FR900359 (EXP) gentamycin (ISO) hydrogen peroxide (EXP) indometacin (EXP) iron dichloride (EXP) leflunomide (EXP) melphalan (EXP) menadione (EXP) methylmercury chloride (EXP) nickel atom (EXP) paracetamol (ISO) PCB138 (ISO) pentanal (EXP) propanal (EXP) quercetin (EXP) resorcinol (EXP) resveratrol (EXP) silicon dioxide (EXP) tert-butyl hydroperoxide (EXP) titanium dioxide (EXP,ISO) trichloroethene (ISO) trichostatin A (EXP) tunicamycin (EXP) valproic acid (EXP) zinc sulfate (EXP)
HOXD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 176,188,668 - 176,190,907 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 176,188,668 - 176,190,907 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 177,053,396 - 177,055,635 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 176,761,553 - 176,763,881 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 176,878,813 - 176,881,142 NCBI Celera 2 170,662,486 - 170,664,814 (+) NCBI Celera Cytogenetic Map 2 q31.1 NCBI HuRef 2 168,930,260 - 168,932,588 (+) NCBI HuRef CHM1_1 2 177,059,181 - 177,061,509 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 176,676,799 - 176,679,038 (+) NCBI T2T-CHM13v2.0
Hoxd1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 74,593,324 - 74,595,486 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 74,593,324 - 74,595,486 (+) Ensembl GRCm39 Ensembl GRCm38 2 74,762,980 - 74,765,142 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 74,762,980 - 74,765,142 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 74,601,037 - 74,603,199 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 74,563,819 - 74,565,982 (+) NCBI MGSCv36 mm8 Celera 2 76,433,115 - 76,435,276 (+) NCBI Celera Cytogenetic Map 2 C3 NCBI cM Map 2 44.13 NCBI
Hoxd1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 80,073,041 - 80,075,180 (+) NCBI GRCr8 mRatBN7.2 3 59,665,629 - 59,667,769 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 59,665,629 - 59,667,769 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 63,052,804 - 63,054,943 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 71,636,445 - 71,638,584 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 69,401,510 - 69,403,649 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 61,685,619 - 61,687,758 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 61,685,619 - 61,687,758 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 68,151,156 - 68,153,295 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 57,377,839 - 57,379,978 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 57,274,308 - 57,275,611 (+) NCBI Celera 3 59,186,877 - 59,189,016 (+) NCBI Celera Cytogenetic Map 3 q23 NCBI
Hoxd1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 20,476,645 - 20,478,604 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 20,476,813 - 20,478,604 (-) NCBI ChiLan1.0 ChiLan1.0
HOXD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 78,856,146 - 78,858,397 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 78,871,121 - 78,873,372 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 63,468,317 - 63,470,658 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 181,176,789 - 181,179,105 (+) NCBI panpan1.1 PanPan1.1 panPan2
HOXD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 36 19,995,326 - 19,997,059 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 36 19,995,323 - 19,997,072 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 36 20,004,663 - 20,006,594 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 36 20,136,108 - 20,138,025 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 20,136,051 - 20,138,025 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 36 20,210,053 - 20,211,984 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 36 20,210,733 - 20,212,644 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 36 20,322,637 - 20,324,574 (+) NCBI UU_Cfam_GSD_1.0
Hoxd1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 137,119,139 - 137,121,389 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936509 5,673,184 - 5,674,521 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936509 5,673,184 - 5,674,636 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HOXD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 81,987,769 - 81,990,134 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 81,987,618 - 81,990,026 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 91,455,233 - 91,457,417 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HOXD1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 61,764,519 - 61,766,846 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 61,764,741 - 61,766,081 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 137,843,997 - 137,846,232 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hoxd1
.
Predicted Target Of
Count of predictions: 368 Count of miRNA genes: 325 Interacting mature miRNAs: 339 Transcripts: ENST00000331462 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
597601401 GWAS1658261_H blood urea nitrogen measurement QTL GWAS1658261 (human) 3e-14 blood urea nitrogen measurement blood urea nitrogen level (CMO:0000049) 2 176188698 176188699 Human 597243070 GWAS1339144_H urate measurement QTL GWAS1339144 (human) 5e-10 urate measurement blood uric acid level (CMO:0000501) 2 176190041 176190042 Human 597024603 GWAS1120677_H glucose-dependent insulinotropic peptide measurement, glucose tolerance test QTL GWAS1120677 (human) 2e-08 glucose-dependent insulinotropic peptide measurement, glucose tolerance test 2 176189453 176189454 Human
RH68884
Human Assembly Chr Position (strand) Source JBrowse GRCh37 2 177,055,411 - 177,055,609 UniSTS GRCh37 Build 36 2 176,763,657 - 176,763,855 RGD NCBI36 Celera 2 170,664,590 - 170,664,788 RGD Cytogenetic Map 2 q31.1 UniSTS Cytogenetic Map 2 q31.2 UniSTS HuRef 2 168,932,364 - 168,932,562 UniSTS GeneMap99-GB4 RH Map 2 577.44 UniSTS NCBI RH Map 2 1374.7 UniSTS
HOXD1_1231
Human Assembly Chr Position (strand) Source JBrowse GRCh37 2 177,054,932 - 177,055,663 UniSTS GRCh37 Build 36 2 176,763,178 - 176,763,909 RGD NCBI36 Celera 2 170,664,111 - 170,664,842 RGD HuRef 2 168,931,885 - 168,932,616 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1202
2317
2389
1534
4227
1071
1812
1
316
629
168
2096
4548
4359
35
3206
809
1488
1390
157
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000331462 ⟹ ENSP00000328598
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 2 176,188,668 - 176,190,907 (+) Ensembl
RefSeq Acc Id:
NM_024501 ⟹ NP_078777
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 2 176,188,668 - 176,190,907 (+) NCBI GRCh37 2 177,053,307 - 177,055,635 (+) ENTREZGENE Build 36 2 176,761,553 - 176,763,881 (+) NCBI Archive HuRef 2 168,930,260 - 168,932,588 (+) ENTREZGENE CHM1_1 2 177,059,181 - 177,061,509 (+) NCBI T2T-CHM13v2.0 2 176,676,799 - 176,679,038 (+) NCBI
Sequence:
GCCATGGGTTGGAGAGGGCAGCTCGGGTAGAGAGGGCTGGCGGAGCGGCGCAGACGGCGGCAGTCCTGCTCAGCCTCTGCCCGGCTCCGTACTCCGGCCCCGGCCTGCGCCCTCAGAAAGGTGGGGCC
hide sequence
RefSeq Acc Id:
XM_047444086 ⟹ XP_047300042
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 2 176,188,668 - 176,190,907 (+) NCBI
RefSeq Acc Id:
XM_054341650 ⟹ XP_054197625
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 2 176,676,799 - 176,679,038 (+) NCBI
RefSeq Acc Id:
NP_078777 ⟸ NM_024501
- UniProtKB:
B2RAB4 (UniProtKB/Swiss-Prot), Q9GZZ0 (UniProtKB/Swiss-Prot), Q96CA4 (UniProtKB/TrEMBL)
- Sequence:
MSSYLEYVSCSSSGGVGGDVLSLAPKFCRSDARPVALQPAFPLGNGDGAFVSCLPLAAARPSPSPPAAPARPSVPPPAAPQYAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGVLGRAADDG
hide sequence
Ensembl Acc Id:
ENSP00000328598 ⟸ ENST00000331462
RefSeq Acc Id:
XP_047300042 ⟸ XM_047444086
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_054197625 ⟸ XM_054341650
- Peptide Label:
isoform X1
RGD ID: 6862138 Promoter ID: EPDNEW_H4234 Type: initiation region Name: HOXD1_1 Description: homeobox D1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 2 176,188,668 - 176,188,728 EPDNEW
