Symbol:
Oasl2
Name:
2'-5' oligoadenylate synthetase-like 2
RGD ID:
1316499
MGI Page
MGI
Description:
Enables 2'-5'-oligoadenylate synthetase activity and double-stranded RNA binding activity. Involved in interleukin-27-mediated signaling pathway and purine nucleotide biosynthetic process. Predicted to be active in cytosol; membrane; and nucleoplasm. Is expressed in central nervous system; retina; right atrium; and thymus primordium. Orthologous to human OASL2P (2'-5' oligoadenylate synthetase like 2, pseudogene).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2'-5'-oligoadenylate synthase-like protein 2; 54 kDa 2'-5'-oligoadenylate synthase-like protein 2; 54 kDa 2'-5'-oligoadenylate synthetase-like protein 2; M1204; Mmu-; Mmu-OASL; Oasl; p54 OASL; p54OASL
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 115,034,995 - 115,050,306 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 115,034,997 - 115,050,295 (+) Ensembl GRCm39 Ensembl GRCm38 5 114,896,926 - 114,912,245 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 114,896,936 - 114,912,234 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 115,346,943 - 115,362,254 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 115,157,933 - 115,173,226 (+) NCBI MGSCv36 mm8 Celera 5 111,989,345 - 112,005,767 (+) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 55.99 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Oasl2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 115,034,995 - 115,050,306 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 115,034,997 - 115,050,295 (+) Ensembl GRCm39 Ensembl GRCm38 5 114,896,926 - 114,912,245 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 114,896,936 - 114,912,234 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 115,346,943 - 115,362,254 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 115,157,933 - 115,173,226 (+) NCBI MGSCv36 mm8 Celera 5 111,989,345 - 112,005,767 (+) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 55.99 NCBI
OASL2P Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 121,053,732 - 121,059,670 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 121,053,732 - 121,059,670 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 121,491,535 - 121,497,473 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Cytogenetic Map 12 q24.31 NCBI T2T-CHM13v2.0 12 121,044,406 - 121,050,354 (-) NCBI T2T-CHM13v2.0
.
Predicted Target Of
Count of predictions: 1695 Count of miRNA genes: 658 Interacting mature miRNAs: 809 Transcripts: ENSMUST00000031542, ENSMUST00000124716, ENSMUST00000129707, ENSMUST00000137828, ENSMUST00000144064, ENSMUST00000146072, ENSMUST00000150361 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301399 Cpfd3_m cerebellum pattern fissures (mouse) Not determined 5 87386871 121387065 Mouse 25314310 Syncl4_m synaptonemal complex length 4 (mouse) 5 103047866 115538059 Mouse 25314315 Mlh1fc4_m MLH1 foci count 4 (mouse) 5 74460661 132528839 Mouse 1357725 Eae39_m experimental allergic encephalomyelitis 39 (mouse) Not determined 5 89418876 118864028 Mouse 14746986 Manh58_m mandible shape 58 (mouse) 5 102446283 136446283 Mouse 1300993 Hycdc_m hypercapnic duty cycle (mouse) Not determined 5 90561006 124561151 Mouse 1301126 Bwem1_m body weight day 30 males 1 (mouse) Not determined 5 87386871 121387065 Mouse 1300659 Pcd8ts1_m p-glycoprotein positive CD8 T cell subset 1 (mouse) Not determined 5 97021753 131021986 Mouse 1301042 Elmaz1_m elevated maze behavior 1 (mouse) Not determined 5 98019649 116876624 Mouse 1300913 Bwefm_m body weight females and males day 10 (mouse) Not determined 5 109439348 143439459 Mouse 10402486 Dipa1_m drug induced psychomotor activation 1 (mouse) Not determined 5 95465549 129465722 Mouse 1357886 Diht_m dopamine-induced hypothermia (mouse) Not determined 5 104498738 115101540 Mouse 10043958 Chldq12_m cholesterol and HDL QTL 12 (mouse) Not determined 5 87386871 121387065 Mouse 26884395 Humsd2_m humerus midshaft diameter 2, 10 week (mouse) 5 70057343 132528839 Mouse 10412202 Bbaa26_m B.burgdorferi-associated arthritis 26 (mouse) Not determined 5 104583688 138555455 Mouse 1301543 Hypch_m hypercholesterolemia (mouse) Not determined 5 109238624 139118905 Mouse 12904945 Tammq2_m tibialis anterior muscle mass QTL 2 (mouse) 5 100665965 134665965 Mouse 4142473 Chlq11_m circulating hormone level QTL 11 (mouse) Not determined 5 107906299 141906412 Mouse 11341716 Rvfs3_m Rift Valley fever susceptibility 3 (mouse) 5 26441234 138455402 Mouse 12904959 Smmq1_m soleus muscle mass QTL 1 (mouse) 5 100665965 134665965 Mouse 10412197 Bbaa25_m B.burgdorferi-associated arthritis 25 (mouse) Not determined 5 109167240 143167381 Mouse 13506928 Recrq8_m recombination rate in male meiosis QTL 8 (mouse) 5 74460661 132528839 Mouse 27226719 Tibw6_m tibia width 6, proximal, 16 week (mouse) 5 72857343 139985755 Mouse 1301457 Cfsw2_m cystic fibrosis survival to weaning 2 (mouse) Not determined 5 90561006 124561151 Mouse 10401245 Bglu18_m blood glucose level 18 (mouse) Not determined 5 82838468 116838597 Mouse 1301974 Chab7_m cholesterol absorption 7 (mouse) Not determined 5 95233214 129233330 Mouse 11528550 Sluc33_m susceptibility to lung cancer 33 (mouse) 5 104386871 120711986 Mouse 1357662 Lprq4_m lipoprotein QTL 4 (mouse) Not determined 5 114021753 129632606 Mouse 4142064 Tmc1m4_m Tmc1 modifier 4 (mouse) Not determined 5 54500177 127001072 Mouse 10412239 Alpq7_m alcohol preference QTL 7 (mouse) Not determined 5 104705939 138705939 Mouse 1300801 Drb2_m dopamine receptor binding 2 (mouse) Not determined 5 87386871 121387065 Mouse 9587780 Afw16_m abdominal fat weight QTL 16 (mouse) Not determined 5 92830166 126830285 Mouse 1357644 Egrd1_m early growth rate, direct effect 1 (mouse) Not determined 5 95434580 129434786 Mouse 12859290 Criq2_m Citrobacter rodentium infection QTL 2 (mouse) 5 101332579 135332579 Mouse 1300940 Actd3_m activity-distance traveled 3 (mouse) Not determined 5 96320385 130320533 Mouse 1301362 Prnr1_m prion resistance 1 (mouse) Not determined 5 89418876 146787935 Mouse 1558774 Lith17_m lithogenic gene 17 (mouse) Not determined 5 95465549 129465722 Mouse 1357431 Cia27_m collagen induced arthritis 27 (mouse) Not determined 5 75315348 120018629 Mouse 1301624 Aevm2_m autoimmune extremity vasculitis in MRL mice 2 (mouse) Not determined 5 101863832 135864028 Mouse 10043890 Trigq4_m triglyceride QTL 4 (mouse) Not determined 5 107906299 141906412 Mouse 4141652 Mrdq2_m modifier of retinal degeneration QTL 2 (mouse) Not determined 110253106 118093673 Mouse 4141139 Hmtb4_m hemostasis and thrombosis rebleeding time 4 (mouse) Not determined 108762509 126882944 Mouse 11532736 Sluc33b_m susceptibility to lung cancer 33b (mouse) 5 102945037 136945196 Mouse 4141519 Hmtb5_m hemostasis and thrombosis bleeding time 5 (mouse) Not determined 99949422 126882944 Mouse 1301858 Smdq1_m segregation of mitochondrial DNA QTL 1 (mouse) Not determined 5 97021753 131021986 Mouse 11049562 Lmr24f_m leishmaniasis resistance 24f (mouse) 5 90320962 124321041 Mouse 13464251 Ahl21_m age related hearing loss, early onset 21 (mouse) 5 109167240 143167381 Mouse 13464244 Ahl19_m age related hearing loss, early onset 19 (mouse) 5 95465549 129465722 Mouse 1300968 Skts4_m skin tumor susceptibility 4 (mouse) Not determined 5 89418876 124238239 Mouse 13464241 Ahl18_m age related hearing loss, early onset 18 (mouse) 5 87386871 121387065 Mouse 1301102 Cia14_m collagen induced arthritis 14 (mouse) Not determined 5 113320385 138555455 Mouse 13464243 Ahl20_m age related hearing loss, early onset 20 (mouse) 5 107906299 141906412 Mouse 13464242 Ahl17_m age related hearing loss, early onset 17 (mouse) 5 82838468 116838597 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000031542 ⟹ ENSMUSP00000031542
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 115,034,997 - 115,050,295 (+) Ensembl GRCm38.p6 Ensembl 5 114,896,936 - 114,912,234 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000124716 ⟹ ENSMUSP00000115070
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 115,039,414 - 115,049,281 (+) Ensembl GRCm38.p6 Ensembl 5 114,901,353 - 114,911,220 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000129707
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 115,042,491 - 115,044,784 (+) Ensembl GRCm38.p6 Ensembl 5 114,904,430 - 114,906,723 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000137828
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 115,035,637 - 115,038,344 (+) Ensembl GRCm38.p6 Ensembl 5 114,897,576 - 114,900,283 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000144064 ⟹ ENSMUSP00000117876
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 115,035,803 - 115,050,287 (+) Ensembl GRCm38.p6 Ensembl 5 114,897,742 - 114,912,226 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000146072 ⟹ ENSMUSP00000117795
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 115,035,062 - 115,037,907 (+) Ensembl GRCm38.p6 Ensembl 5 114,897,001 - 114,899,846 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000150361 ⟹ ENSMUSP00000119042
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 115,035,091 - 115,038,032 (+) Ensembl GRCm38.p6 Ensembl 5 114,897,030 - 114,899,971 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000201445
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 115,039,895 - 115,042,002 (+) Ensembl GRCm38.p6 Ensembl 5 114,901,834 - 114,903,941 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000201919
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 115,035,593 - 115,036,411 (+) Ensembl GRCm38.p6 Ensembl 5 114,897,532 - 114,898,350 (+) Ensembl
RefSeq Acc Id:
NM_001359181 ⟹ NP_001346110
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 115,034,995 - 115,050,306 (+) NCBI GRCm38 5 114,896,934 - 114,912,245 (+) NCBI
Sequence:
CACTCACTGAAGATAACTAGACAGAAAACATCGTGAGACTACCTCACGCTGTCCATTGACCAGGAGCAATCCTTTGTGCCTCACATCTTTGGGACTGCGGTAGGCATCAGAGAAATGTCACCTCGATG
hide sequence
RefSeq Acc Id:
NM_011854 ⟹ NP_035984
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 115,034,995 - 115,050,306 (+) NCBI GRCm38 5 114,896,934 - 114,912,245 (+) ENTREZGENE MGSCv37 5 115,346,943 - 115,362,254 (+) RGD Celera 5 111,989,345 - 112,005,767 (+) RGD cM Map 5 ENTREZGENE
Sequence:
CACTCACTGAAGATAACTAGACAGAAAACATCGTGAGACTACCTCACGCTGTCCATTGACCAGG
hide sequence
RefSeq Acc Id:
XM_006530314 ⟹ XP_006530377
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 115,035,020 - 115,050,291 (+) NCBI GRCm38 5 114,896,926 - 114,912,232 (+) NCBI
Sequence:
AAACATCGTGAGACTACCTCACGCTGTCCATTGACCAGGAGCAATCCTTTGTGCCTCACATCTTTGGGACTGCGGTAGGCATCAGAGAAATGTCACCTCGATGGGCCCTGCAGCTGGAGAGTCTGACC
hide sequence
RefSeq Acc Id:
XM_006530315 ⟹ XP_006530378
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 115,035,020 - 115,050,291 (+) NCBI GRCm38 5 114,896,931 - 114,912,232 (+) NCBI
Sequence:
AAACATCGTGAGACTACCTCACGCTGTCCATTGACCAGGAGCAATCCTTTGTGCCTCACATCTTTGGGACTGCGGTAGGCATCAGAGAAATGTCACCTCGATGGGCCCTGCAGCTGGAGAGTCTGACC
hide sequence
RefSeq Acc Id:
NP_035984 ⟸ NM_011854
- Peptide Label:
isoform 1
- UniProtKB:
Q9D6S2 (UniProtKB/Swiss-Prot), Q9Z2F2 (UniProtKB/Swiss-Prot), Q8K234 (UniProtKB/TrEMBL)
- Sequence:
MDPFPDLYATPGDSLDHFLEHSLQPQRDWKEEGQDAWERIERFFREQCFRDELLLDQEVRVIKVVKGGSSGKGTTLNHRSDQDMILFLSCFSSFEEQARNREVVISFIKKRLIHCSRSLAYNIIVLTH
hide sequence
RefSeq Acc Id:
XP_006530378 ⟸ XM_006530315
- Peptide Label:
isoform X1
- UniProtKB:
Q9D6S2 (UniProtKB/Swiss-Prot), Q9Z2F2 (UniProtKB/Swiss-Prot), Q8K234 (UniProtKB/TrEMBL)
- Sequence:
MDPFPDLYATPGDSLDHFLEHSLQPQRDWKEEGQDAWERIERFFREQCFRDELLLDQEVRVIKVVKGGSSGKGTTLNHRSDQDMILFLSCFSSFEEQARNREVVISFIKKRLIHCSRSLAYNIIVLTH
hide sequence
RefSeq Acc Id:
XP_006530377 ⟸ XM_006530314
- Peptide Label:
isoform X1
- UniProtKB:
Q9D6S2 (UniProtKB/Swiss-Prot), Q9Z2F2 (UniProtKB/Swiss-Prot), Q8K234 (UniProtKB/TrEMBL)
- Sequence:
MDPFPDLYATPGDSLDHFLEHSLQPQRDWKEEGQDAWERIERFFREQCFRDELLLDQEVRVIKVVKGGSSGKGTTLNHRSDQDMILFLSCFSSFEEQARNREVVISFIKKRLIHCSRSLAYNIIVLTH
hide sequence
RefSeq Acc Id:
NP_001346110 ⟸ NM_001359181
- Peptide Label:
isoform 2
- UniProtKB:
F6VMV6 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000119042 ⟸ ENSMUST00000150361
Ensembl Acc Id:
ENSMUSP00000117876 ⟸ ENSMUST00000144064
Ensembl Acc Id:
ENSMUSP00000115070 ⟸ ENSMUST00000124716
Ensembl Acc Id:
ENSMUSP00000031542 ⟸ ENSMUST00000031542
Ensembl Acc Id:
ENSMUSP00000117795 ⟸ ENSMUST00000146072
RGD ID: 6887704 Promoter ID: EPDNEW_M7303 Type: initiation region Name: Oasl2_2 Description: Mus musculus 2'-5' oligoadenylate synthetase-like 2 , transcriptvariant 2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M7304 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 5 114,896,984 - 114,897,044 EPDNEW
RGD ID: 6887706 Promoter ID: EPDNEW_M7304 Type: initiation region Name: Oasl2_1 Description: Mus musculus 2'-5' oligoadenylate synthetase-like 2 , transcriptvariant 2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M7303 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 5 114,897,569 - 114,897,629 EPDNEW
RGD ID: 6837983 Promoter ID: MM_KWN:43608 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Liver, Lung Transcripts: NM_011854, OTTMUST00000034640, OTTMUST00000034641, OTTMUST00000034642, OTTMUST00000040921 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 115,347,241 - 115,347,772 (+) MPROMDB
RGD ID: 6837984 Promoter ID: MM_KWN:43609 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, BoneMarrow_4Hour Transcripts: OTTMUST00000034643 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 115,350,791 - 115,351,577 (+) MPROMDB
RGD ID: 6837985 Promoter ID: MM_KWN:43610 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour Transcripts: OTTMUST00000034644 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 115,354,371 - 115,354,992 (+) MPROMDB
