Advanced Search (OLGA)

Gene: Tppp3 (tubulin polymerization-promoting protein family member 3) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Tppp3

Name:

tubulin polymerization-promoting protein family member 3

RGD ID:

1312867

MGI Page

MGI

Description:

Predicted to enable tubulin binding activity. Involved in embryo implantation. Predicted to colocalize with microtubule; microtubule bundle; and perinuclear region of cytoplasm. Is expressed in several structures, including blastocyst; limb; musculature; nervous system; and sensory organ. Orthologous to human TPPP3 (tubulin polymerization promoting protein family member 3).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

2700055K07Rik; Ceacam9; CGI-38; mmCGM8

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	106,194,124 - 106,198,189 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	106,194,125 - 106,198,158 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	105,467,492 - 105,471,422 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	105,467,493 - 105,471,526 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	107,991,392 - 107,995,322 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	108,356,621 - 108,360,496 (-)	NCBI		MGSCv36	mm8
Celera	8	109,690,684 - 109,694,614 (-)	NCBI		Celera
Cytogenetic Map	8	D3	NCBI
cM Map	8	53.04	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tppp3	Mouse	autosomal dominant dyskeratosis congenita 6		ISO	TPPP3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dyskeratosis congenita and autosomal dominant 6	ClinVar	PMID:28492532
Tppp3	Mouse	Chromosome 16q12 Duplication Syndrome		ISO	TPPP3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 16q12 duplication syndrome	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tppp3	Mouse	(1->4)-beta-D-glucan	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TPPP3 mRNA	CTD	PMID:36331819
Tppp3	Mouse	1,2-dimethylhydrazine	increases expression	EXP		6480464	1 and 2-Dimethylhydrazine results in increased expression of TPPP3 mRNA	CTD	PMID:22206623
Tppp3	Mouse	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of TPPP3 mRNA	CTD	PMID:19484750
Tppp3	Mouse	17beta-estradiol	decreases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Estradiol results in decreased expression of TPPP3 mRNA	CTD	PMID:32145629
Tppp3	Mouse	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	EXP		6480464	Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to TPPP3 promoter]	CTD	PMID:19654925
Tppp3	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in increased expression of TPPP3 mRNA	CTD	PMID:34747641
Tppp3	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of TPPP3 mRNA	CTD	PMID:21570461
Tppp3	Mouse	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	EXP		6480464	2 more ...	CTD	PMID:38648751
Tppp3	Mouse	4,4'-sulfonyldiphenol	increases expression	EXP		6480464	bisphenol S results in increased expression of TPPP3 mRNA	CTD	PMID:30951980
Tppp3	Mouse	4-hydroxyphenyl retinamide	decreases expression	EXP		6480464	Fenretinide results in decreased expression of TPPP3 mRNA	CTD	PMID:28973697
Tppp3	Mouse	6-propyl-2-thiouracil	decreases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Propylthiouracil results in decreased expression of TPPP3 mRNA	CTD	PMID:24780913 and PMID:25825206
Tppp3	Mouse	7,12-dimethyltetraphene	decreases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	9 more ...	CTD	PMID:19480007
Tppp3	Mouse	7,12-dimethyltetraphene	multiple interactions	EXP		6480464	[Dietary Fats co-treated with Dietary Sucrose co-treated with 9 more ...	CTD	PMID:39910959
Tppp3	Mouse	all-trans-retinoic acid	increases expression	ISO	TPPP3 (Homo sapiens)	6480464	Tretinoin results in increased expression of TPPP3 mRNA	CTD	PMID:33167477
Tppp3	Mouse	alpha-Zearalanol	multiple interactions	ISO	Tppp3 (Rattus norvegicus)	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of TPPP3 mRNA	CTD	PMID:35163327
Tppp3	Mouse	amphetamine	increases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Amphetamine results in increased expression of TPPP3 mRNA	CTD	PMID:30779732
Tppp3	Mouse	arsane	affects methylation	ISO	TPPP3 (Homo sapiens)	6480464	Arsenic affects the methylation of TPPP3 gene	CTD	PMID:25304211
Tppp3	Mouse	arsenic atom	affects methylation	ISO	TPPP3 (Homo sapiens)	6480464	Arsenic affects the methylation of TPPP3 gene	CTD	PMID:25304211
Tppp3	Mouse	atrazine	decreases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Atrazine results in decreased expression of TPPP3 mRNA	CTD	PMID:36841081
Tppp3	Mouse	benzo[a]pyrene	decreases expression	ISO	TPPP3 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of TPPP3 mRNA	CTD	PMID:21871943
Tppp3	Mouse	benzo[a]pyrene	affects methylation	ISO	TPPP3 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of TPPP3 5' UTR and Benzo(a)pyrene affects the methylation of TPPP3 promoter	CTD	PMID:27901495
Tppp3	Mouse	beta-naphthoflavone	decreases expression	ISO	TPPP3 (Homo sapiens)	6480464	beta-Naphthoflavone results in decreased expression of TPPP3 mRNA	CTD	PMID:32858204
Tppp3	Mouse	bisphenol A	affects expression	ISO	TPPP3 (Homo sapiens)	6480464	bisphenol A affects the expression of TPPP3 mRNA	CTD	PMID:20170705
Tppp3	Mouse	bisphenol A	decreases expression	ISO	TPPP3 (Homo sapiens)	6480464	bisphenol A results in decreased expression of TPPP3 protein	CTD	PMID:37664457
Tppp3	Mouse	bisphenol A	decreases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of TPPP3 mRNA	CTD	PMID:32145629
Tppp3	Mouse	bisphenol A	affects expression	ISO	Tppp3 (Rattus norvegicus)	6480464	bisphenol A affects the expression of TPPP3 mRNA	CTD	PMID:32145629
Tppp3	Mouse	bisphenol A	increases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of TPPP3 mRNA	CTD	PMID:25181051
Tppp3	Mouse	bisphenol F	increases expression	EXP		6480464	bisphenol F results in increased expression of TPPP3 mRNA	CTD	PMID:30951980
Tppp3	Mouse	bleomycin A2	decreases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Bleomycin results in decreased expression of TPPP3 protein	CTD	PMID:25933445
Tppp3	Mouse	cadmium atom	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TPPP3 mRNA	CTD	PMID:37325564
Tppp3	Mouse	cadmium dichloride	decreases expression	ISO	TPPP3 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of TPPP3 mRNA	CTD	PMID:38382870
Tppp3	Mouse	cadmium dichloride	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TPPP3 mRNA	CTD	PMID:37325564
Tppp3	Mouse	cantharidin	decreases expression	EXP		6480464	Cantharidin results in decreased expression of TPPP3 mRNA	CTD	PMID:36907384
Tppp3	Mouse	carbon nanotube	decreases expression	EXP		6480464	Nanotubes more ...	CTD	PMID:25554681
Tppp3	Mouse	carbonyl sulfide	decreases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	carbonyl sulfide results in decreased expression of TPPP3 mRNA	CTD	PMID:19395590
Tppp3	Mouse	chlordecone	increases expression	EXP		6480464	Chlordecone results in increased expression of TPPP3 mRNA	CTD	PMID:33711761
Tppp3	Mouse	cisplatin	multiple interactions	ISO	TPPP3 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of TPPP3 mRNA	CTD	PMID:27392435
Tppp3	Mouse	cisplatin	decreases expression	ISO	TPPP3 (Homo sapiens)	6480464	Cisplatin results in decreased expression of TPPP3 mRNA	CTD	PMID:27392435
Tppp3	Mouse	Cuprizon	decreases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Cuprizone results in decreased expression of TPPP3 mRNA	CTD	PMID:26577399 and PMID:27523638
Tppp3	Mouse	cyclosporin A	increases expression	ISO	TPPP3 (Homo sapiens)	6480464	Cyclosporine results in increased expression of TPPP3 mRNA	CTD	PMID:33631201
Tppp3	Mouse	decabromodiphenyl ether	multiple interactions	ISO	Tppp3 (Rattus norvegicus)	6480464	[Flame Retardants co-treated with pentabromodiphenyl ether co-treated with decabromobiphenyl ether co-treated with hexabromocyclododecane] results in decreased expression of TPPP3 mRNA	CTD	PMID:32207525
Tppp3	Mouse	deguelin	decreases expression	ISO	TPPP3 (Homo sapiens)	6480464	deguelin results in decreased expression of TPPP3 mRNA	CTD	PMID:33512557
Tppp3	Mouse	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of TPPP3 mRNA	CTD	PMID:17361019 and PMID:21266533
Tppp3	Mouse	diethylstilbestrol	decreases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Diethylstilbestrol results in decreased expression of TPPP3 mRNA	CTD	PMID:21658437
Tppp3	Mouse	dioxygen	multiple interactions	EXP		6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TPPP3 mRNA	CTD	PMID:30529165
Tppp3	Mouse	diuron	decreases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Diuron results in decreased expression of TPPP3 mRNA	CTD	PMID:25152437
Tppp3	Mouse	diuron	increases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Diuron results in increased expression of TPPP3 mRNA	CTD	PMID:21551480
Tppp3	Mouse	fipronil	decreases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	fipronil results in decreased expression of TPPP3 mRNA	CTD	PMID:23962444
Tppp3	Mouse	furan	increases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	furan results in increased expression of TPPP3 mRNA	CTD	PMID:27387713
Tppp3	Mouse	iron atom	increases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Iron deficiency results in increased expression of TPPP3 mRNA	CTD	PMID:16629162
Tppp3	Mouse	iron(0)	increases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Iron deficiency results in increased expression of TPPP3 mRNA	CTD	PMID:16629162
Tppp3	Mouse	monosodium L-glutamate	decreases expression	EXP		6480464	Sodium Glutamate results in decreased expression of TPPP3 mRNA	CTD	PMID:22078008
Tppp3	Mouse	N-methyl-4-phenylpyridinium	increases expression	ISO	TPPP3 (Homo sapiens)	6480464	1-Methyl-4-phenylpyridinium results in increased expression of TPPP3 mRNA	CTD	PMID:24810058
Tppp3	Mouse	ozone	decreases expression	EXP		6480464	Ozone results in decreased expression of TPPP3 mRNA	CTD	PMID:31626304
Tppp3	Mouse	ozone	multiple interactions	EXP		6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of TPPP3 mRNA	CTD	PMID:34911549
Tppp3	Mouse	paracetamol	decreases expression	ISO	TPPP3 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of TPPP3 mRNA	CTD	PMID:26690555
Tppp3	Mouse	paracetamol	decreases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Acetaminophen results in decreased expression of TPPP3 mRNA	CTD	PMID:30723492
Tppp3	Mouse	perfluorooctane-1-sulfonic acid	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TPPP3 mRNA	CTD	PMID:36331819
Tppp3	Mouse	perfluorooctanoic acid	multiple interactions	ISO	Tppp3 (Rattus norvegicus)	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of TPPP3 mRNA	CTD	PMID:35163327
Tppp3	Mouse	pirinixic acid	multiple interactions	ISO	TPPP3 (Homo sapiens)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of TPPP3 mRNA	CTD	PMID:19710929
Tppp3	Mouse	progesterone	increases expression	EXP		6480464	Progesterone results in increased expression of TPPP3 mRNA	CTD	PMID:22238285
Tppp3	Mouse	rotenone	decreases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Rotenone results in decreased expression of TPPP3 mRNA	CTD	PMID:28374803
Tppp3	Mouse	silicon dioxide	decreases expression	ISO	TPPP3 (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of TPPP3 mRNA	CTD	PMID:25895662
Tppp3	Mouse	sodium arsenite	increases expression	ISO	TPPP3 (Homo sapiens)	6480464	sodium arsenite results in increased expression of TPPP3 mRNA	CTD	PMID:38568856
Tppp3	Mouse	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of TPPP3 mRNA	CTD	PMID:37682722
Tppp3	Mouse	sodium arsenite	decreases expression	ISO	TPPP3 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of TPPP3 mRNA	CTD	PMID:34032870
Tppp3	Mouse	sodium fluoride	increases expression	EXP		6480464	Sodium Fluoride results in increased expression of TPPP3 protein	CTD	PMID:28918527
Tppp3	Mouse	Soman	increases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Soman results in increased expression of TPPP3 mRNA	CTD	PMID:19281266
Tppp3	Mouse	titanium dioxide	increases methylation	EXP		6480464	titanium dioxide results in increased methylation of TPPP3 promoter	CTD	PMID:35295148
Tppp3	Mouse	trichloroethene	increases expression	ISO	Tppp3 (Rattus norvegicus)	6480464	Trichloroethylene results in increased expression of TPPP3 mRNA	CTD	PMID:33387578
Tppp3	Mouse	triclosan	decreases expression	ISO	TPPP3 (Homo sapiens)	6480464	Triclosan results in decreased expression of TPPP3 mRNA	CTD	PMID:30510588
Tppp3	Mouse	triphenyl phosphate	affects expression	ISO	TPPP3 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of TPPP3 mRNA	CTD	PMID:37042841
Tppp3	Mouse	triptonide	increases expression	EXP		6480464	triptonide results in increased expression of TPPP3 mRNA	CTD	PMID:33045310
Tppp3	Mouse	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of TPPP3 mRNA	CTD	PMID:21427059
Tppp3	Mouse	vinclozolin	affects expression	ISO	Tppp3 (Rattus norvegicus)	6480464	vinclozolin affects the expression of TPPP3 mRNA	CTD	PMID:19015723

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tppp3	Mouse	decidualization	involved_in	ISO	UniProtKB:Q9BW30	2290270		GO_Central	GO_REF:0000119
Tppp3	Mouse	decidualization	involved_in	ISS	UniProtKB:Q9BW30	2290270		UniProt	GO_REF:0000024
Tppp3	Mouse	embryo implantation	involved_in	IMP		2290270	PMID:29901777	UniProt	PMID:29901777
Tppp3	Mouse	microtubule bundle formation	involved_in	IBA	PANTHER:PTN000309419 more ...	2290270		GO_Central	GO_REF:0000033
Tppp3	Mouse	microtubule bundle formation	involved_in	ISO	UniProtKB:Q9BW30	2290270		GO_Central	GO_REF:0000119
Tppp3	Mouse	microtubule bundle formation	involved_in	ISS	UniProtKB:Q9BW30	2290270		UniProt	GO_REF:0000024
Tppp3	Mouse	microtubule polymerization	involved_in	IEA	InterPro:IPR008907	2290270		InterPro	GO_REF:0000002
Tppp3	Mouse	microtubule polymerization	involved_in	IBA	PANTHER:PTN000309419 more ...	2290270		GO_Central	GO_REF:0000033
Tppp3	Mouse	positive regulation of protein polymerization	involved_in	IBA	PANTHER:PTN000309419 and UniProtKB:O94811	2290270		GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tppp3	Mouse	microtubule	located_in	IBA	PANTHER:PTN000309419 more ...	2290270		GO_Central	GO_REF:0000033
Tppp3	Mouse	microtubule	located_in	IEA	UniProtKB-KW:KW-0493	2290270		UniProt	GO_REF:0000043
Tppp3	Mouse	microtubule bundle	located_in	IEA	UniProtKB:Q9BW30 and ensembl:ENSP00000377529	2290270		Ensembl	GO_REF:0000107
Tppp3	Mouse	microtubule bundle	located_in	ISO	UniProtKB:Q9BW30	2290270		GO_Central	GO_REF:0000119
Tppp3	Mouse	perinuclear region of cytoplasm	located_in	IEA	UniProtKB:Q9BW30 and ensembl:ENSP00000377529	2290270		Ensembl	GO_REF:0000107
Tppp3	Mouse	perinuclear region of cytoplasm	located_in	ISO	UniProtKB:Q9BW30	2290270		GO_Central	GO_REF:0000119

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tppp3	Mouse	tubulin binding	enables	IBA	PANTHER:PTN000309419 more ...	2290270		GO_Central	GO_REF:0000033
Tppp3	Mouse	tubulin binding	enables	ISS	UniProtKB:Q9BW30	2290270		UniProt	GO_REF:0000024
Tppp3	Mouse	tubulin binding	enables	ISO	UniProtKB:Q9BW30	2290270		GO_Central	GO_REF:0000119

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tppp3	Mouse	abnormal digit morphology		IEA		5509061		MGI
Tppp3	Mouse	abnormal lymph node morphology		IEA		5509061		MGI
Tppp3	Mouse	abnormal spleen morphology		IEA		5509061		MGI
Tppp3	Mouse	abnormal thymus morphology		IEA		5509061		MGI
Tppp3	Mouse	abnormal tooth color		IEA		5509061		MGI
Tppp3	Mouse	abnormal tooth morphology		IEA		5509061		MGI
Tppp3	Mouse	enlarged lymph nodes		IEA		5509061		MGI
Tppp3	Mouse	enlarged spleen		IEA		5509061		MGI
Tppp3	Mouse	enlarged thymus		IEA		5509061		MGI
Tppp3	Mouse	increased CD4-positive NK T cell number		IEA		5509061		MGI
Tppp3	Mouse	increased memory-marker CD4-positive NK T cell number		IEA		5509061		MGI
Tppp3	Mouse	increased NK T cell number		IEA		5509061		MGI
Tppp3	Mouse	preweaning lethality, complete penetrance		IEA		5509061		MGI

#	Reference Title	Reference Citation
1.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	MGDs mouse GO annotations	MGD data from the GO Consortium
3.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:10349636	PMID:10922068	PMID:11042159	PMID:11076861	PMID:12477932	PMID:14610273	PMID:15489334	PMID:15537664	PMID:16141072	PMID:16141073	PMID:16602821
PMID:16943360	PMID:18799693	PMID:19235716	PMID:20571904	PMID:20696843	PMID:21267068	PMID:21677750	PMID:21873635	PMID:24154528	PMID:25926361	PMID:27914912	PMID:29467244
PMID:29901777	PMID:30104731	PMID:30667362	PMID:30745426	PMID:31488818	PMID:31768046	PMID:32515350	PMID:38117901	PMID:38355793

Tppp3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	106,194,124 - 106,198,189 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	106,194,125 - 106,198,158 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	105,467,492 - 105,471,422 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	105,467,493 - 105,471,526 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	107,991,392 - 107,995,322 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	108,356,621 - 108,360,496 (-)	NCBI		MGSCv36	mm8
Celera	8	109,690,684 - 109,694,614 (-)	NCBI		Celera
Cytogenetic Map	8	D3	NCBI
cM Map	8	53.04	NCBI

TPPP3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	67,389,809 - 67,393,498 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	67,389,809 - 67,393,518 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	67,423,712 - 67,427,401 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	65,981,213 - 65,984,922 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	51,931,912 - 51,935,621 (-)	NCBI		Celera
Cytogenetic Map	16	q22.1	NCBI
HuRef	16	53,296,948 - 53,300,657 (-)	NCBI		HuRef
CHM1_1	16	68,831,095 - 68,834,804 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	73,184,580 - 73,188,269 (-)	NCBI		T2T-CHM13v2.0

Tppp3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	50,255,809 - 50,259,655 (-)	NCBI		GRCr8
mRatBN7.2	19	33,345,897 - 33,349,610 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	33,345,898 - 33,349,577 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	40,161,487 - 40,165,153 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	40,814,815 - 40,818,481 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	43,105,458 - 43,109,125 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	37,424,323 - 37,428,075 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	37,424,324 - 37,427,989 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	48,289,940 - 48,293,636 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	35,284,039 - 35,287,705 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	35,288,920 - 35,292,586 (-)	NCBI
Celera	19	32,774,202 - 32,777,868 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

Tppp3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955484	9,246,734 - 9,250,293 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955484	9,246,734 - 9,250,293 (+)	NCBI	ChiLan1.0	ChiLan1.0

TPPP3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	76,919,479 - 76,923,243 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	82,832,147 - 82,835,922 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	47,735,260 - 47,738,959 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	67,124,224 - 67,127,928 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	67,124,224 - 67,127,919 (-)	Ensembl	panpan1.1		panPan2

TPPP3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	82,007,708 - 82,011,321 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	82,007,730 - 82,011,139 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	81,997,227 - 82,000,890 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	82,442,874 - 82,446,547 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	82,442,946 - 82,456,118 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	82,269,006 - 82,272,679 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	81,950,114 - 81,953,769 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	82,593,564 - 82,597,217 (+)	NCBI		UU_Cfam_GSD_1.0

Tppp3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	41,740,145 - 41,743,879 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	17,845,235 - 17,849,060 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	17,845,235 - 17,849,694 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TPPP3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	28,045,438 - 28,046,998 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	28,045,433 - 28,051,141 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	25,312,516 - 25,316,184 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TPPP3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	60,063,418 - 60,067,166 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	60,063,457 - 60,067,210 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	22,812,766 - 22,816,519 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tppp3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	18,922,164 - 18,926,543 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	18,922,539 - 18,926,195 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Tppp3
219 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	782
Count of miRNA genes:	291
Interacting mature miRNAs:	340
Transcripts:	ENSMUST00000014990, ENSMUST00000176419, ENSMUST00000177126
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300560	Tgl1_m	triglyceride level 1 (mouse)			Not determined		8	102486208	111650036	Mouse
4141435	Fbtq3_m	femoral bone trait QTL 3 (mouse)			Not determined		8	100965309	130127694	Mouse
11252141	Fdr2_m	fat response to dietary restriction 2 (mouse)					8	98390634	130127694	Mouse
1357470	Obq16_m	obesity QTL 16 (mouse)			Not determined		8	76411976	110412125	Mouse
1302105	Im1_m	Immunoregulatory 1 (mouse)			Not determined		8	99828531	130127694	Mouse
1301080	Sluc9_m	susceptibility to lung cancer 9 (mouse)			Not determined		8	99828531	130127694	Mouse
1558875	Eae31_m	experimental allergic encephalomyelitis susceptibility 31 (mouse)			Not determined		8	35109930	115563747	Mouse
10412234	Nhdlq14_m	non-HDL QTL 14 (mouse)			Not determined		8	76411976	110412125	Mouse
1301766	Desp1_m	despair 1 (mouse)			Not determined		8	85486208	119486373	Mouse
1301253	Skmw2_m	skeletal muscle weight 2 (mouse)			Not determined		8	86443553	120443701	Mouse
1301316	Dntcs1_m	dental caries susceptibility 1 (mouse)			Not determined		8	103443553	127781786	Mouse
4140967	Bmd39_m	bone mineral density 39 (mouse)			Not determined		8	32506572	117965439	Mouse
1357708	Orq1_m	ovulation rate QTL 1 (mouse)			Not determined		8	71740461	124622354	Mouse
1300681	Pgia22_m	proteoglycan induced arthritis 22 (mouse)			Not determined		8	102486208	116025457	Mouse
10755519	Wbc1_m	white blood cell count 1 (mouse)					8	82345783	116345783	Mouse
27226754	Femd6_m	femur midshaft diameter 6, 10 week (mouse)					8	37867154	110326632	Mouse
1301581	Char2_m	P. chabaudi malaria resistance QTL 2 (mouse)			Not determined		8	79808806	113809031	Mouse
1301874	Hdlq16_m	HDL QTL 16 (mouse)			Not determined		8	76411976	110412125	Mouse
1357494	Obsty2_m	obesity 2 (mouse)			Not determined		8	96245241	129745061	Mouse
10045619	Heal14_m	wound healing/regeneration 14 (mouse)			Not determined		8	86443553	120443701	Mouse
1300920	Pitm3_m	prion incubation time 3 (mouse)			Not determined		8	73929123	107929226	Mouse
12880431	Fgf23lq2_m	FGF23 serum level QTL 2 (mouse)					8	97626632	130127694	Mouse
10755530	Wbc2_m	white blood cell count 2 (mouse)					8	81819296	115819296	Mouse
1302049	Heal1_m	wound healing/regeneration 1 (mouse)			Not determined		8	86443553	120443701	Mouse
27226796	Scvln16_m	sacral vertebrae length 2, 16 week (mouse)					8	89726628	130027694	Mouse
27095912	Pglq14_m	pelvic girdle length QTL 14, 16 week (mouse)					8	74126628	126826739	Mouse
4142023	W3q5_m	weight 3 weeks QTL 5 (mouse)			Not determined			71740461	124622354	Mouse
1301099	Cbm2_m	cerebellum weight 2 (mouse)			Not determined		8	79245241	113245331	Mouse
1301481	Lith11_m	lithogenic gene 11 (mouse)			Not determined		8	98563635	130127694	Mouse
11532692	Sluc38a_m	susceptibility to lung cancer 38a (mouse)					8	105033977	130127694	Mouse
11532691	Sluc38_m	susceptibility to lung cancer 38 (mouse)					8	105033977	130127694	Mouse
1558890	Lith18_m	lithogenic gene 18 (mouse)			Not determined		8	76402145	110402251	Mouse

MARC_24063-24064:1030024087:1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	105,467,945 - 105,468,546	UniSTS	GRCm38
MGSCv37	8	107,991,845 - 107,992,446	UniSTS	GRCm37
Celera	8	109,691,137 - 109,691,738	UniSTS
Cytogenetic Map	8	D1	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_026481	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_036154254	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC090480	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK003376	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK009771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK012437	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK155018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK160507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AW494372	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC010788	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC116622	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BF469439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000014990 ⟹ ENSMUSP00000014990

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	106,194,125 - 106,198,158 (-)	Ensembl
GRCm38.p6 Ensembl	8	105,467,493 - 105,471,526 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000176419 ⟹ ENSMUSP00000134807

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	106,194,315 - 106,195,294 (-)	Ensembl
GRCm38.p6 Ensembl	8	105,467,683 - 105,468,662 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000177126 ⟹ ENSMUSP00000135040

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	106,194,301 - 106,196,042 (-)	Ensembl
GRCm38.p6 Ensembl	8	105,467,669 - 105,469,410 (-)	Ensembl

RefSeq Acc Id:

NM_026481 ⟹ NP_080757

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	106,194,124 - 106,198,054 (-)	NCBI
GRCm38	8	105,467,492 - 105,471,422 (-)	ENTREZGENE
MGSCv37	8	107,991,392 - 107,995,322 (-)	RGD
Celera	8	109,690,684 - 109,694,614 (-)	RGD
cM Map	8		ENTREZGENE

Sequence:

show sequence

GGGATAATACTACGGAGCCGCCCGGGCTGCAGTCCCGCCCGGGAGCCGGCAGGGAGCGGAGCTGTGGAGCCTCCTGGTCTCCAGCATCAGTTCCTGGGTCCTGTCCGAAGGCACGCTCAGGAGCAGCC
AAGCGGTAGAAGCCGGGTGGCATGGCAGCGAGCACGGACATAGCTGGGCTGGAGGAGAGCTTCCGGAAGTTTGCCATCCATGGCGACCCCAAGGCCAGCGGGCAAGAGATGAATGGCAAGAACTGGGC
CAAGCTGTGCAAGGACTGTAAGGTGGCCGACGGAAAGGCCGTAACGGGCACCGACGTCGACATCGTCTTCTCCAAAGTCAAGGCGAAATCTGCTAGAGTAATCAACTATGAGGAGTTCAAGAAGGCCC
TGGAAGAGCTGGCAACTAAGCGGTTCAAGGGGAAGTCCAAGGAGGAGGCCTTTGATGCCATCTGCCAGCTGATAGCGGGCAAGGAACCGGCCAACATTGGCGTCACCAAAGCTAAAACGGGTGGTGCT
GTGGACCGGCTGACGGACACCAGTAAGTATACGGGCTCCCACAAAGAACGCTTTGATGAGAGCGGCAAGGGAAAGGGCATCGCTGGACGGCAGGACATCCTGGACGACAGTGGCTACGTGAGTGCCTA
CAAAAACGCAGGCACCTATGACGCCAAGGTGAAGAAGTGACACCTGCCAAAGCCCCCAGGGAGGCTGTCCCACTGGAGGCCCAGGCCTGGGGTCCAGGGTCACATGGAGCAAGAAAGCCTGGCTCCCT
CCCTGCTGGATCTGCCACCAAGAGCTTCCTGCCCAGTCCCAGGGCCATCCCATCAGGCCTCTGACCCAGACTGCTGTGTCCCTTCTTCCTGTCTCCCTGTCATCTGTCTGGGAGTCAGTGCCTATATC
CTCACCGCCCCAGCCTGGTCCCAGGCATGGCTGACTCTTGCCTGCTTTTGCCTCATATTTAAGCTGCTGCTCTGGCCAAGTGCCTAATTCTTACCCAGACCTCAATAAAGATACCTTTTGTACCAGGA
AAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_036154254 ⟹ XP_036010147

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	106,194,124 - 106,198,189 (-)	NCBI

Sequence:

show sequence

CAATTCTGCGGGCCCAGCGCCCACAGAGCACATAGGGCGGGGTCTGGTGGGAGGAGCTAGCGTG
ACCTTGGTCACTCTCCCGCCGAGACAGCCTAGGGGGTGGGACTCACTGTCTCTATGGTGACCGAGAAACAGGGGATAATACTACGGAGCCGCCCGGGCTGCAGTCCCGCCCGGGAGCCGGCAGGGAGC
GGAGCTGTGGAGCCTCCTGGTCTCCAGCATCAGTTCCTGGGTCCTGTCCGAAGGCACGCTCAGGAGCAGCCAAGCGGTAGAAGCCGGGTTTCTCTGTATAGCCCTGGCTGTCCCGGAACTTACTTTGT
AGACCAGGCTGGCCTCGAACTCAGAAAGTTGCCTGCCTCTGCCTCCCCAGTGCTGGGATTAAAGGCGTGCGCCACCACTGCCCAGCACCTCACAGGGTGGCATGGCAGCGAGCACGGACATAGCTGGG
CTGGAGGAGAGCTTCCGGAAGTTTGCCATCCATGGCGACCCCAAGGCCAGCGGGCAAGAGATGAATGGCAAGAACTGGGCCAAGCTGTGCAAGGACTGTAAGGTGGCCGACGGAAAGGCCGTAACGGG
CACCGACGTCGACATCGTCTTCTCCAAAGTCAAGGCGAAATCTGCTAGAGTAATCAACTATGAGGAGTTCAAGAAGGCCCTGGAAGAGCTGGCAACTAAGCGGTTCAAGGGGAAGTCCAAGGAGGAGG
CCTTTGATGCCATCTGCCAGCTGATAGCGGGCAAGGAACCGGCCAACATTGGCGTCACCAAAGCTAAAACGGGTGGTGCTGTGGACCGGCTGACGGACACCAGTAAGTATACGGGCTCCCACAAAGAA
CGCTTTGATGAGAGCGGCAAGGGAAAGGGCATCGCTGGACGGCAGGACATCCTGGACGACAGTGGCTACGTGAGTGCCTACAAAAACGCAGGCACCTATGACGCCAAGGTGAAGAAGTGACACCTGCC
AAAGCCCCCAGGGAGGCTGTCCCACTGGAGGCCCAGGCCTGGGGTCCAGGGTCACATGGAGCAAGAAAGCCTGGCTCCCTCCCTGCTGGATCTGCCACCAAGAGCTTCCTGCCCAGTCCCAGGGCCAT
CCCATCAGGCCTCTGACCCAGACTGCTGTGTCCCTTCTTCCTGTCTCCCTGTCATCTGTCTGGGAGTCAGTGCCTATATCCTCACCGCCCCAGCCTGGTCCCAGGCATGGCTGACTCTTGCCTGCTTT
TGCCTCATATTTAAGCTGCTGCTCTGGCCAAGTGCCTAATTCTTACCCAGACCTCAATAAAGATACCTTTTGTACCAGGA

hide sequence


Protein RefSeqs	NP_080757	(Get FASTA)	NCBI Sequence Viewer
	XP_036010147	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH10788	(Get FASTA)	NCBI Sequence Viewer
	AAI16623	(Get FASTA)	NCBI Sequence Viewer
	BAB26493	(Get FASTA)	NCBI Sequence Viewer
	BAB28237	(Get FASTA)	NCBI Sequence Viewer
	BAE32991	(Get FASTA)	NCBI Sequence Viewer
	BAE35831	(Get FASTA)	NCBI Sequence Viewer
	EDL11282	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000014990
	ENSMUSP00000014990.7
	ENSMUSP00000134807.2
	ENSMUSP00000135040
	ENSMUSP00000135040.2
GenBank Protein	Q9CRB6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_080757 ⟸ NM_026481
- UniProtKB:	Q3TUZ0 (UniProtKB/Swiss-Prot), Q9CRB6 (UniProtKB/Swiss-Prot), Q1JPR8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAASTDIAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLIAGKEPANIGVTKAKTGGAVDRLTDT SKYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK hide sequence

Ensembl Acc Id:

ENSMUSP00000135040 ⟸ ENSMUST00000177126

Ensembl Acc Id:

ENSMUSP00000014990 ⟸ ENSMUST00000014990

Ensembl Acc Id:

ENSMUSP00000134807 ⟸ ENSMUST00000176419

RefSeq Acc Id:	XP_036010147 ⟸ XM_036154254
- Peptide Label:	isoform X1
- UniProtKB:	Q9CRB6 (UniProtKB/Swiss-Prot), Q3TUZ0 (UniProtKB/Swiss-Prot), Q1JPR8 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9CRB6-F1-model_v2	AlphaFold	Q9CRB6	1-176	view protein structure

RGD ID:

8668093

Promoter ID:

EPDNEW_M12078

Type:

multiple initiation site

Name:

Tppp3_1

Description:

Mus musculus tubulin polymerization-promoting protein familymember 3 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	8	105,471,392 - 105,471,452	EPDNEW

RGD ID:

6843835

Promoter ID:

MM_KWN:55552

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Kidney, Lung

Transcripts:

NM_026481_TPPP3

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	8	107,995,006 - 107,995,506 (-)	MPROMDB

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000014846	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000014990	ENTREZGENE
	ENSMUST00000014990.13	UniProtKB/Swiss-Prot
	ENSMUST00000176419.2	UniProtKB/Swiss-Prot
	ENSMUST00000177126	ENTREZGENE
	ENSMUST00000177126.8	UniProtKB/Swiss-Prot
Gene3D-CATH	EF-hand	UniProtKB/Swiss-Prot
InterPro	EF-hand-dom_pair	UniProtKB/Swiss-Prot
	P25-alpha	UniProtKB/Swiss-Prot
KEGG Report	mmu:67971	UniProtKB/Swiss-Prot
MGD	MGI:1915221	ENTREZGENE
NCBI Gene	67971	ENTREZGENE
PANTHER	PTHR12932	UniProtKB/Swiss-Prot
	PTHR12932:SF16	UniProtKB/Swiss-Prot
Pfam	p25-alpha	UniProtKB/Swiss-Prot
PhenoGen	Tppp3	PhenoGen
Superfamily-SCOP	SSF47473	UniProtKB/Swiss-Prot
UniProt	Q1JPR8	ENTREZGENE, UniProtKB/TrEMBL
	Q3TUZ0	ENTREZGENE
	Q9CRB6	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q3TUZ0	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype