Symbol:
Lrp11
Name:
LDL receptor related protein 11
RGD ID:
1308602
Description:
Predicted to enable phosphoprotein binding activity. Predicted to be involved in several processes, including response to cold; response to heat; and response to water deprivation. Predicted to be located in membrane. Orthologous to human LRP11 (LDL receptor related protein 11); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC108348623; LOC292462; low density lipoprotein receptor-related protein 11; low-density lipoprotein receptor-related protein 11; uncharacterized LOC108348623
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 3,868,665 - 3,928,513 (+) NCBI GRCr8 mRatBN7.2 1 2,048,307 - 2,108,115 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 2,079,438 - 2,108,110 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 1,729,407 - 1,757,939 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 7,729,801 - 7,758,337 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 2,011,504 - 2,040,040 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 1,702,696 - 1,731,210 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 1,702,696 - 1,731,210 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 3,400,376 - 3,428,890 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 2,255,892 - 2,284,328 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 2,255,572 - 2,284,326 (+) NCBI Celera 1 627,810 - 656,231 (+) NCBI Celera Cytogenetic Map 1 p13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lrp11 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO LRP11 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of LRP11 mRNA CTD PMID:22079256 Lrp11 Rat 1,2-dichloroethane increases expression ISO Lrp11 (Mus musculus) 6480464 ethylene dichloride results in increased expression of LRP11 mRNA CTD PMID:28960355 Lrp11 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of LRP11 mRNA CTD PMID:32145629 Lrp11 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO LRP11 (Homo sapiens) 6480464 2 more ... CTD PMID:19095052 Lrp11 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Lrp11 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to LRP11 promoter] CTD PMID:19654925 Lrp11 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of LRP11 mRNA CTD PMID:33387578 Lrp11 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO LRP11 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of LRP11 mRNA CTD PMID:20106945 more ... Lrp11 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Lrp11 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of LRP11 mRNA CTD PMID:21570461 and PMID:26377647 Lrp11 Rat 3-methylcholanthrene multiple interactions ISO LRP11 (Homo sapiens) 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to LRP11 promoter] CTD PMID:20348232 Lrp11 Rat 4,4'-diaminodiphenylmethane affects expression ISO Lrp11 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of LRP11 mRNA CTD PMID:18648102 Lrp11 Rat 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid decreases expression ISO LRP11 (Homo sapiens) 6480464 Am 580 results in decreased expression of LRP11 mRNA CTD PMID:16982809 Lrp11 Rat 4-hydroxyphenyl retinamide decreases expression ISO Lrp11 (Mus musculus) 6480464 Fenretinide results in decreased expression of LRP11 mRNA CTD PMID:28973697 Lrp11 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of LRP11 mRNA CTD PMID:30047161 Lrp11 Rat aflatoxin B1 affects expression ISO LRP11 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of LRP11 protein CTD PMID:20106945 Lrp11 Rat aflatoxin B1 increases methylation ISO LRP11 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of LRP11 gene CTD PMID:28458013 Lrp11 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of LRP11 mRNA CTD PMID:20488242 Lrp11 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of LRP11 mRNA CTD PMID:30047161 Lrp11 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of LRP11 mRNA CTD PMID:30779732 Lrp11 Rat arsane multiple interactions ISO LRP11 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LRP11 mRNA CTD PMID:39836092 Lrp11 Rat arsenic atom multiple interactions ISO LRP11 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LRP11 mRNA CTD PMID:39836092 Lrp11 Rat benzo[a]pyrene increases expression ISO LRP11 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of LRP11 mRNA CTD PMID:20106945 more ... Lrp11 Rat benzo[b]fluoranthene increases expression ISO Lrp11 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of LRP11 mRNA CTD PMID:26377693 Lrp11 Rat bis(2-ethylhexyl) phthalate increases expression ISO Lrp11 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of LRP11 mRNA CTD PMID:34319233 Lrp11 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of LRP11 mRNA CTD PMID:25181051 Lrp11 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LRP11 mRNA CTD PMID:30816183 more ... Lrp11 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of LRP11 mRNA CTD PMID:31129395 Lrp11 Rat bisphenol F increases expression ISO Lrp11 (Mus musculus) 6480464 bisphenol F results in increased expression of LRP11 mRNA CTD PMID:38685157 Lrp11 Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of LRP11 mRNA CTD PMID:24136188 Lrp11 Rat butanal decreases expression ISO LRP11 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of LRP11 mRNA CTD PMID:26079696 Lrp11 Rat carbamazepine affects expression ISO LRP11 (Homo sapiens) 6480464 Carbamazepine affects the expression of LRP11 mRNA CTD PMID:25979313 Lrp11 Rat chlordecone multiple interactions ISO Lrp11 (Mus musculus) 6480464 Chlordecone promotes the reaction [Biomarkers metabolite binds to LRP11 gene] CTD PMID:31084621 Lrp11 Rat chlorpyrifos increases expression ISO Lrp11 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of LRP11 mRNA CTD PMID:32715474 and PMID:37019170 Lrp11 Rat choline multiple interactions ISO Lrp11 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LRP11 mRNA CTD PMID:20938992 Lrp11 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of LRP11 mRNA CTD PMID:22023808 Lrp11 Rat cisplatin increases expression ISO LRP11 (Homo sapiens) 6480464 Cisplatin results in increased expression of LRP11 mRNA CTD PMID:27594783 Lrp11 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of LRP11 mRNA CTD PMID:30556269 Lrp11 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of LRP11 mRNA CTD PMID:30556269 Lrp11 Rat copper(II) sulfate decreases expression ISO LRP11 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of LRP11 mRNA CTD PMID:19549813 Lrp11 Rat cyclosporin A decreases expression ISO LRP11 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of LRP11 mRNA CTD PMID:25562108 Lrp11 Rat dorsomorphin multiple interactions ISO LRP11 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Lrp11 Rat doxorubicin increases expression ISO LRP11 (Homo sapiens) 6480464 Doxorubicin results in increased expression of LRP11 mRNA CTD PMID:29803840 Lrp11 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of LRP11 mRNA CTD PMID:29391264 Lrp11 Rat ethanol affects splicing ISO Lrp11 (Mus musculus) 6480464 Ethanol affects the splicing of LRP11 mRNA CTD PMID:30319688 Lrp11 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of LRP11 mRNA CTD PMID:24136188 Lrp11 Rat folic acid multiple interactions ISO Lrp11 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LRP11 mRNA CTD PMID:20938992 Lrp11 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of LRP11 mRNA CTD PMID:33387578 Lrp11 Rat L-methionine multiple interactions ISO Lrp11 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LRP11 mRNA CTD PMID:20938992 Lrp11 Rat lead(0) affects expression ISO LRP11 (Homo sapiens) 6480464 Lead affects the expression of LRP11 mRNA CTD PMID:28903495 Lrp11 Rat leflunomide increases expression ISO LRP11 (Homo sapiens) 6480464 leflunomide results in increased expression of LRP11 mRNA CTD PMID:28988120 Lrp11 Rat manganese atom multiple interactions ISO LRP11 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of LRP11 mRNA CTD PMID:39836092 Lrp11 Rat manganese(0) multiple interactions ISO LRP11 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of LRP11 mRNA CTD PMID:39836092 Lrp11 Rat manganese(II) chloride multiple interactions ISO LRP11 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of LRP11 mRNA CTD PMID:39836092 Lrp11 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of LRP11 mRNA CTD PMID:30047161 Lrp11 Rat methylmercury chloride increases expression ISO LRP11 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of LRP11 mRNA CTD PMID:28001369 Lrp11 Rat N-methyl-4-phenylpyridinium increases expression ISO LRP11 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of LRP11 mRNA CTD PMID:24810058 Lrp11 Rat ozone multiple interactions ISO Lrp11 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of LRP11 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of LRP11 mRNA CTD PMID:34911549 Lrp11 Rat paracetamol increases expression ISO LRP11 (Homo sapiens) 6480464 Acetaminophen results in increased expression of LRP11 mRNA CTD PMID:21420995 and PMID:29067470 Lrp11 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of LRP11 mRNA CTD PMID:33387578 Lrp11 Rat perfluorononanoic acid affects expression ISO LRP11 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid affects the expression of LRP11 protein CTD PMID:38537583 Lrp11 Rat perfluorooctanoic acid increases expression ISO Lrp11 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of LRP11 mRNA CTD PMID:30657992 Lrp11 Rat phenobarbital multiple interactions ISO Lrp11 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of LRP11 mRNA] CTD PMID:19482888 Lrp11 Rat phenobarbital increases expression ISO Lrp11 (Mus musculus) 6480464 Phenobarbital results in increased expression of LRP11 mRNA CTD PMID:19482888 Lrp11 Rat phenylmercury acetate increases expression ISO LRP11 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of LRP11 mRNA CTD PMID:26272509 Lrp11 Rat phenylmercury acetate multiple interactions ISO LRP11 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LRP11 mRNA CTD PMID:27188386 Lrp11 Rat pirinixic acid increases expression ISO Lrp11 (Mus musculus) 6480464 pirinixic acid results in increased expression of LRP11 mRNA CTD PMID:23811191 Lrp11 Rat potassium chromate decreases expression ISO LRP11 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of LRP11 mRNA CTD PMID:22079256 Lrp11 Rat potassium chromate multiple interactions ISO LRP11 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of LRP11 mRNA CTD PMID:22079256 Lrp11 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of LRP11 mRNA CTD PMID:30047161 Lrp11 Rat propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of LRP11 mRNA CTD PMID:30047161 Lrp11 Rat SB 431542 multiple interactions ISO LRP11 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Lrp11 Rat silicon dioxide decreases expression ISO LRP11 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of LRP11 mRNA CTD PMID:25895662 Lrp11 Rat sodium arsenite decreases expression ISO LRP11 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of LRP11 mRNA CTD PMID:21457566 and PMID:38568856 Lrp11 Rat sodium arsenite decreases expression ISO Lrp11 (Mus musculus) 6480464 sodium arsenite results in decreased expression of LRP11 mRNA CTD PMID:37682722 Lrp11 Rat sodium arsenite multiple interactions ISO LRP11 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LRP11 mRNA CTD PMID:39836092 Lrp11 Rat temozolomide decreases expression ISO LRP11 (Homo sapiens) 6480464 Temozolomide results in decreased expression of LRP11 mRNA CTD PMID:31758290 Lrp11 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of LRP11 mRNA CTD PMID:31150632 Lrp11 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of LRP11 mRNA CTD PMID:34492290 Lrp11 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of LRP11 mRNA CTD PMID:31129395 Lrp11 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of LRP11 gene CTD PMID:27618143 Lrp11 Rat trichostatin A increases expression ISO LRP11 (Homo sapiens) 6480464 trichostatin A results in increased expression of LRP11 mRNA CTD PMID:24935251 Lrp11 Rat triptonide affects expression ISO Lrp11 (Mus musculus) 6480464 triptonide affects the expression of LRP11 mRNA CTD PMID:33045310 Lrp11 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of LRP11 mRNA CTD PMID:24136188 Lrp11 Rat valproic acid affects expression ISO LRP11 (Homo sapiens) 6480464 Valproic Acid affects the expression of LRP11 mRNA CTD PMID:25979313 Lrp11 Rat valproic acid multiple interactions ISO LRP11 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LRP11 mRNA CTD PMID:27188386 Lrp11 Rat valproic acid increases expression ISO LRP11 (Homo sapiens) 6480464 Valproic Acid results in increased expression of LRP11 mRNA CTD PMID:23179753 more ... Lrp11 Rat valproic acid decreases methylation ISO LRP11 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of LRP11 gene CTD PMID:29154799 Lrp11 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of LRP11 mRNA CTD PMID:22570695
(-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (ISO) 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP) amitrole (EXP) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) bisphenol F (ISO) buspirone (EXP) butanal (ISO) carbamazepine (ISO) chlordecone (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (EXP,ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) flutamide (EXP) folic acid (ISO) gentamycin (EXP) L-methionine (ISO) lead(0) (ISO) leflunomide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methimazole (EXP) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorononanoic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (EXP) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) temozolomide (ISO) tetrachloromethane (EXP) thioacetamide (EXP) tributylstannane (EXP) trichloroethene (EXP) trichostatin A (ISO) triptonide (ISO) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP)
Lrp11 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 3,868,665 - 3,928,513 (+) NCBI GRCr8 mRatBN7.2 1 2,048,307 - 2,108,115 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 2,079,438 - 2,108,110 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 1,729,407 - 1,757,939 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 7,729,801 - 7,758,337 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 2,011,504 - 2,040,040 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 1,702,696 - 1,731,210 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 1,702,696 - 1,731,210 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 3,400,376 - 3,428,890 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 2,255,892 - 2,284,328 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 2,255,572 - 2,284,326 (+) NCBI Celera 1 627,810 - 656,231 (+) NCBI Celera Cytogenetic Map 1 p13 NCBI
LRP11 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 149,818,757 - 149,864,359 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 149,818,757 - 149,864,359 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 150,139,893 - 150,185,495 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 150,181,625 - 150,227,173 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 150,232,047 - 150,277,594 NCBI Celera 6 150,874,576 - 150,920,142 (-) NCBI Celera Cytogenetic Map 6 q25.1 NCBI HuRef 6 147,705,413 - 147,750,966 (-) NCBI HuRef CHM1_1 6 150,404,503 - 150,450,092 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 151,018,123 - 151,063,700 (-) NCBI T2T-CHM13v2.0
Lrp11 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 7,465,532 - 7,501,247 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 7,465,564 - 7,501,247 (+) Ensembl GRCm39 Ensembl GRCm38 10 7,589,817 - 7,624,768 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 7,589,800 - 7,625,483 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 7,309,598 - 7,345,281 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 7,280,007 - 7,315,665 (+) NCBI MGSCv36 mm8 Celera 10 7,466,883 - 7,504,024 (+) NCBI Celera Cytogenetic Map 10 A1 NCBI cM Map 10 2.23 NCBI
Lrp11 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955439 11,426,283 - 11,475,260 (+) NCBI ChiLan1.0 ChiLan1.0
LRP11 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 169,837,204 - 169,882,414 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 167,730,807 - 167,776,404 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 147,630,742 - 147,676,322 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 152,336,565 - 152,381,664 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 152,336,565 - 152,381,664 (-) Ensembl panpan1.1 panPan2
LRP11 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 40,545,864 - 40,590,492 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 40,545,421 - 40,591,286 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 41,384,289 - 41,432,830 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 40,726,928 - 40,775,778 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 40,733,653 - 40,772,711 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 40,602,644 - 40,648,301 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 40,468,658 - 40,514,453 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 40,809,143 - 40,857,953 (-) NCBI UU_Cfam_GSD_1.0
Lrp11 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 135,471,018 - 135,517,723 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936489 2,722,886 - 2,770,160 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936489 2,723,086 - 2,769,928 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LRP11 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 16,139,496 - 16,198,969 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 16,139,227 - 16,198,974 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 18,476,652 - 18,537,105 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LRP11 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 21,760,342 - 21,802,241 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 21,760,411 - 21,802,242 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 197,792,395 - 197,833,192 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lrp11
.
Predicted Target Of
Count of predictions: 387 Count of miRNA genes: 228 Interacting mature miRNAs: 280 Transcripts: ENSRNOT00000019181 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
2298546 Neuinf4 Neuroinflammation QTL 4 5.1 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 1 1 28736750 Rat 2313090 Bmd69 Bone mineral density QTL 69 4.4 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 1 32356093 Rat 1578650 Bmd6 Bone mineral density QTL 6 12.2 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 1 509108 43284926 Rat 1354647 Despr8 Despair related QTL 8 0.0000341 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 1 24744506 Rat 1578651 Bmd7 Bone mineral density QTL 7 14.2 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 1 509108 43284926 Rat 1578669 Bss9 Bone structure and strength QTL 9 6.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 1 509108 43284926 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2313070 Bss52 Bone structure and strength QTL 52 4.4 0.0001 body length (VT:0001256) body length (CMO:0000013) 1 1 32356093 Rat 2313053 Bss51 Bone structure and strength QTL 51 3.8 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 1 32356093 Rat 738020 Pia8 Pristane induced arthritis QTL 8 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 1 65833076 Rat
RH131343
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 2,107,859 - 2,108,079 (+) MAPPER mRatBN7.2 Rnor_6.0 1 1,730,960 - 1,731,179 NCBI Rnor6.0 Rnor_5.0 1 3,428,640 - 3,428,859 UniSTS Rnor5.0 RGSC_v3.4 1 2,284,078 - 2,284,297 UniSTS RGSC3.4 Celera 1 655,981 - 656,200 UniSTS Cytogenetic Map 1 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019181 ⟹ ENSRNOP00000019181
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 2,079,438 - 2,108,110 (+) Ensembl Rnor_6.0 Ensembl 1 1,702,696 - 1,731,210 (+) Ensembl
RefSeq Acc Id:
NM_001106217 ⟹ NP_001099687
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 3,899,995 - 3,928,513 (+) NCBI mRatBN7.2 1 2,079,604 - 2,108,115 (+) NCBI Rnor_6.0 1 1,702,696 - 1,731,210 (+) NCBI Rnor_5.0 1 3,400,376 - 3,428,890 (+) NCBI RGSC_v3.4 1 2,255,892 - 2,284,328 (+) RGD Celera 1 627,810 - 656,231 (+) RGD
Sequence:
CCGCCGCAGCCGCTGTCCTCACGCCGGTGCTGATCCACGTAAAGGCCGCTCGTCGCCCCGGTGCGCTTCCGCGGCCGGAGCGAAGATAGGGGCACCGAAAGCCCACAGCCTGGTAGAAGGGCCAGGGC
hide sequence
RefSeq Acc Id:
XM_039103574 ⟹ XP_038959502
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 3,889,702 - 3,928,513 (+) NCBI mRatBN7.2 1 2,078,944 - 2,108,115 (+) NCBI
RefSeq Acc Id:
XM_039103584 ⟹ XP_038959512
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 3,889,702 - 3,928,513 (+) NCBI mRatBN7.2 1 2,078,936 - 2,108,115 (+) NCBI
RefSeq Acc Id:
XM_039103592 ⟹ XP_038959520
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 3,889,702 - 3,928,513 (+) NCBI mRatBN7.2 1 2,078,926 - 2,108,115 (+) NCBI
RefSeq Acc Id:
XM_063282916 ⟹ XP_063138986
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 3,889,702 - 3,919,620 (+) NCBI
RefSeq Acc Id:
XM_063282917 ⟹ XP_063138987
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 3,889,702 - 3,928,513 (+) NCBI
RefSeq Acc Id:
XM_063282919 ⟹ XP_063138989
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 3,868,665 - 3,928,513 (+) NCBI
RefSeq Acc Id:
NP_001099687 ⟸ NM_001106217
- Peptide Label:
precursor
- Sequence:
MKVPQPGTLKLSHLKEGAYVFQLTVTDSVGQRSSDNVSVTVLPRLRSTGGCSSACSRYHFFCDNGCCIDIALACDGVRQCPDGSDEDFCQNLATSAQPGATGLNEGEGDPWLEKSQKATTHNQPATVS
hide sequence
Ensembl Acc Id:
ENSRNOP00000019181 ⟸ ENSRNOT00000019181
RefSeq Acc Id:
XP_038959520 ⟸ XM_039103592
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038959512 ⟸ XM_039103584
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038959502 ⟸ XM_039103574
- Peptide Label:
isoform X1
- UniProtKB:
F1M753 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063138989 ⟸ XM_063282919
- Peptide Label:
isoform X6
- UniProtKB:
A6JP08 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063138987 ⟸ XM_063282917
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063138986 ⟸ XM_063282916
- Peptide Label:
isoform X2
RGD ID: 13689478 Promoter ID: EPDNEW_R2 Type: initiation region Name: Lrp11_1 Description: LDL receptor related protein 11 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 1,702,716 - 1,702,776 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Lrp11
LDL receptor related protein 11
LOC108348623
uncharacterized LOC108348623
Data merged from RGD:11485595
737654 PROVISIONAL
2016-08-02
LOC108348623
uncharacterized LOC108348623
Symbol and Name status set to provisional
70820 PROVISIONAL
2015-12-11
Lrp11
LDL receptor related protein 11
Lrp11
low density lipoprotein receptor-related protein 11
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Lrp11
low density lipoprotein receptor-related protein 11
Lrp11_predicted
low density lipoprotein receptor-related protein 11 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Lrp11_predicted
low density lipoprotein receptor-related protein 11 (predicted)
Symbol and Name status set to approved
70820 APPROVED
