Ctf1 (cardiotrophin 1) - Rat Genome Database

Name: Ctf1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Ctf1 (cardiotrophin 1) Chinchilla lanigera

Analyze

Symbol:

Ctf1

Name:

cardiotrophin 1

RGD ID:

10102463

Description:

ENCODES a protein that exhibits cytokine activity (ortholog); leukemia inhibitory factor receptor binding (ortholog); INVOLVED IN leukemia inhibitory factor signaling pathway (ortholog); nervous system development (ortholog); neuron development (ortholog); ASSOCIATED WITH abdominal obesity-metabolic syndrome (ortholog); branched-chain keto acid dehydrogenase kinase deficiency (ortholog); Cardiomegaly (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

cardiotrophin-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CTF1 (cardiotrophin 1)	NCBI	Ortholog
Mus musculus (house mouse):	Ctf1 (cardiotrophin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Ctf1 (cardiotrophin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CTF1 (cardiotrophin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CTF1 (cardiotrophin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ctf1 (cardiotrophin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CTF1 (cardiotrophin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103231119 (cardiotrophin-1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ctf1 (cardiotrophin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

NCBI Annotation Information:

Annotation category: partial on reference assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955493	7,735,996 - 7,737,559 (+)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

abdominal obesity-metabolic syndrome (ISO)

branched-chain keto acid dehydrogenase kinase deficiency (ISO)

Cardiomegaly (ISO)

cardiomyopathy (ISO)

dilated cardiomyopathy (ISO)

familial hypertrophic cardiomyopathy (ISO)

generalized epilepsy with febrile seizures plus 9 (ISO)

Hypercholesterolemia (ISO)

hypertension (ISO)

hypertrophic cardiomyopathy (ISO)

Hypotension (ISO)

Insulin Resistance (ISO)

kidney disease (ISO)

Left Ventricular Hypertrophy (ISO)

Necrosis (ISO)

obesity (ISO)

type 2 diabetes mellitus (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

leukemia inhibitory factor signaling pathway (ISO)

nervous system development (ISO)

neuron development (ISO)

positive regulation of tyrosine phosphorylation of STAT protein (ISO)

Molecular Function

cytokine activity (ISO)

leukemia inhibitory factor receptor binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Transitive Annotation Pipeline	Automated assignment of GO, PW and RDO ISO annotations across species

Genomics

Comparative Map Data

Ctf1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955493	7,735,996 - 7,737,559 (+)	NCBI	ChiLan1.0	ChiLan1.0

CTF1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	30,895,846 - 30,903,560 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	30,896,614 - 30,903,547 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	30,907,935 - 30,914,881 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	30,815,429 - 30,822,382 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	30,815,428 - 30,822,381	NCBI
Celera	16	29,382,737 - 29,389,814 (-)	NCBI		Celera
Cytogenetic Map	16	p11.2	NCBI
HuRef	16	28,470,690 - 28,477,682 (+)	NCBI		HuRef
CHM1_1	16	32,225,018 - 32,231,972 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	31,283,287 - 31,291,024 (+)	NCBI		T2T-CHM13v2.0

Ctf1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	127,311,872 - 127,317,360 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	127,311,908 - 127,317,364 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	127,712,676 - 127,718,188 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	127,712,736 - 127,718,192 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	134,856,250 - 134,861,699 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	127,503,884 - 127,509,333 (+)	NCBI		MGSCv36	mm8
Celera	7	127,551,798 - 127,557,251 (+)	NCBI		Celera
Cytogenetic Map	7	F3	NCBI
cM Map	7	69.69	NCBI

Ctf1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	191,758,512 - 191,771,259 (+)	NCBI		GRCr8
mRatBN7.2	1	182,328,035 - 182,336,346 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	182,328,090 - 182,333,335 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	190,678,674 - 190,683,883 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	197,864,766 - 197,869,976 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	190,535,271 - 190,540,479 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	199,162,319 - 199,168,296 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	199,163,086 - 199,168,296 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	206,186,511 - 206,191,930 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	187,001,445 - 187,006,655 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	187,151,325 - 187,156,536 (+)	NCBI
Celera	1	179,979,246 - 179,984,456 (+)	NCBI		Celera
Cytogenetic Map	1	q37	NCBI

CTF1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	34,101,941 - 34,109,044 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	38,903,404 - 38,910,508 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	24,065,866 - 24,072,973 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	31,263,009 - 31,269,439 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

CTF1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	17,299,561 - 17,303,095 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	17,299,561 - 17,303,095 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	18,874,611 - 18,878,145 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	17,427,691 - 17,433,408 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	17,406,389 - 17,433,403 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	17,230,218 - 17,233,760 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	17,149,372 - 17,152,903 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	17,461,913 - 17,465,457 (-)	NCBI		UU_Cfam_GSD_1.0

Ctf1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	125,188,961 - 125,193,420 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936501	13,286,821 - 13,291,280 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CTF1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	17,539,941 - 17,544,396 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	17,539,927 - 17,545,250 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	17,955,024 - 17,960,632 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103231119
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	27,579,175 - 27,586,779 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	27,579,987 - 27,585,759 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	1,878,594 - 1,886,866 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ctf1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624782	13,976,308 - 13,979,327 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_013504887	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01061222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBCE01176310	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBDI01227883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

XM_013504887 ⟹ XP_013360341

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955493	7,735,996 - 7,737,559 (+)	NCBI

Sequence:

show sequence

CCCTTCTTCCCCCCTGGGAAGGGGGGCGTGGAGGGAGCCGGGATCAGCCAGGGGCCAGCATGAG
CCTGAGGGAGGGAAGTCTGGAAGACCCCCAGGCTGACTCCTCAGTCTCATTCCTTCCTCACTTG
GAGGCCAAGATCCGTCAGACACACAGCCTTGCCCGCCTCCTCACCAAATACGCTGAGCAGCTGC
TCCAGGAATATGTGCAGCACCAGGGAGCCCCCTTCGGCTCGCCCGGCTTCTCGCCGCCGCGGCC
GCCGCTGGCCGGCCTGAGCGCACCGGCGCCGGGCCACGCGGGGCTGCCGCTGCCCGAGCGGCTG
CGTCTGGACGCGGTGGCGCTGGCCGAGCTGCCCCCGCTGCTGGACGCCGTGCGCCGCCGCCAGG
CCGAGCTGACCCCGCGCGCGCCGCGCCTGCTGCGGCGTCTGGAGGACGCGGCGCGCCAGACCCG
CGCGCTGGGCGCCGCCGTGGAGACCGTGCTGGCCGCGCTGGGCGCCGCCGCCCCCGCGCCCCGC
CGCGAGCCCCCGGCCGCAGCCGCCGCCGCCGCCCCCGCGGGC

hide sequence

Protein Sequences


Protein RefSeqs	XP_013360341	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	XP_013360341 ⟸ XM_013504887
- Sequence:	show sequence MSLREGSLEDPQADSSVSFLPHLEAKIRQTHSLARLLTKYAEQLLQEYVQHQGAPFGSPGFSPP RPPLAGLSAPAPGHAGLPLPERLRLDAVALAELPPLLDAVRRRQAELTPRAPRLLRRLEDAARQ TRALGAAVETVLAALGAAAPAPRREPPAAAAAAAPAG hide sequence

Additional Information

External Database Links

Database	Acc Id	Source(s)
NCBI Gene	Ctf1	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI