Advanced Search (OLGA)

Gene: Ip6k1 (inositol hexakisphosphate kinase 1) Rattus norvegicus

Analyze

Symbol:

Ip6k1

Name:

inositol hexakisphosphate kinase 1

RGD ID:

71025

Description:

Predicted to enable inositol hexakisphosphate kinase activity. Predicted to be involved in inositol phosphate biosynthetic process; negative regulation of cold-induced thermogenesis; and phosphatidylinositol phosphate biosynthetic process. Predicted to be located in cytosol; fibrillar center; and nucleoplasm. Predicted to be active in cytoplasm and nucleus. Orthologous to human IP6K1 (inositol hexakisphosphate kinase 1); PARTICIPATES IN inositol phosphate metabolic pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Ihpk1; inositol hexakisphosphate kinase 6; inositol hexaphosphate kinase 1; insP6 kinase 1; Itpk6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IP6K1 (inositol hexakisphosphate kinase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ip6k1 (inositol hexaphosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ip6k1 (inositol hexakisphosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IP6K1 (inositol hexakisphosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IP6K1 (inositol hexakisphosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ip6k1 (inositol hexakisphosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IP6K1 (inositol hexakisphosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IP6K1 (inositol hexakisphosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ip6k1 (inositol hexakisphosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ip6k1 (inositol hexakisphosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Ip6k1 (inositol hexaphosphate kinase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IP6K1 (inositol hexakisphosphate kinase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ip6k1 (inositol hexakisphosphate kinase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10082	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10082	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F30A10.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F30A10.3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	KCS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	KCS1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ARG82	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	ip6k1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	117,594,177 - 117,613,266 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	117,594,317 - 117,613,274 (+)	Ensembl				GRCr8
mRatBN7.2	8	108,693,068 - 108,737,278 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	8	114,341,861 - 114,360,950 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	112,541,185 - 112,560,274 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	110,383,824 - 110,402,914 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	116,781,957 - 116,826,152 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	116,804,451 - 116,823,540 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	116,136,279 - 116,180,474 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	113,294,932 - 113,314,025 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	108,020,289 - 108,039,387 (+)	NCBI		Celera
RGSC_v3.1	8	113,292,261 - 113,336,090 (+)	NCBI
Cytogenetic Map	8	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (EXP,ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

bisphenol A (EXP,ISO)

buspirone (EXP)

cadmium dichloride (EXP)

carbon nanotube (ISO)

chlorpyrifos (ISO)

choline (ISO)

chromium(6+) (ISO)

copper(II) sulfate (ISO)

ethanol (ISO)

folic acid (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

L-methionine (ISO)

LY294002 (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methamphetamine (ISO)

methidathion (ISO)

methimazole (EXP)

methylphenidate (ISO)

Mono-carboxy isooctyl phthalate (ISO)

ozone (ISO)

paclitaxel (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylarsine oxide (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (EXP)

titanium dioxide (ISO)

tremolite asbestos (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

U-73122 (ISO)

undecane (EXP)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

inositol phosphate biosynthetic process (IBA,IEA)

negative regulation of cold-induced thermogenesis (IEA,ISO,ISS)

phosphatidylinositol phosphate biosynthetic process (IBA,IEA,ISO,ISS)

Cellular Component

cytoplasm (IBA,IEA,ISO)

cytosol (IEA,ISO)

fibrillar center (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

Molecular Function

ATP binding (IEA)

inositol hexakisphosphate 5-kinase activity (IEA)

inositol hexakisphosphate kinase activity (IBA,IEA,ISO)

kinase activity (IEA)

nucleotide binding (IEA)

protein binding (IPI,ISO)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

inositol phosphate metabolic pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	GRAB: a physiologic guanine nucleotide exchange factor for Rab3A, which interacts with inositol hexakisphosphate kinase.	Luo HR, etal., Neuron 2001 Aug 16;31(3):439-51.
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Synthesis of diphosphoinositol pentakisphosphate by a newly identified family of higher inositol polyphosphate kinases.	Saiardi A, etal., Curr Biol 1999 Nov 18;9(22):1323-6.
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
10.	Adipocyte-specific deletion of Ip6k1 reduces diet-induced obesity by enhancing AMPK-mediated thermogenesis.	Zhu Q, etal., J Clin Invest. 2016 Nov 1;126(11):4273-4288. doi: 10.1172/JCI85510. Epub 2016 Oct 4.

Additional References at PubMed

PMID:11502751	PMID:15489334	PMID:22778403

Genomics

Comparative Map Data

Ip6k1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	117,594,177 - 117,613,266 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	117,594,317 - 117,613,274 (+)	Ensembl				GRCr8
mRatBN7.2	8	108,693,068 - 108,737,278 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	8	114,341,861 - 114,360,950 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	112,541,185 - 112,560,274 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	110,383,824 - 110,402,914 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	116,781,957 - 116,826,152 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	116,804,451 - 116,823,540 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	116,136,279 - 116,180,474 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	113,294,932 - 113,314,025 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	108,020,289 - 108,039,387 (+)	NCBI		Celera
RGSC_v3.1	8	113,292,261 - 113,336,090 (+)	NCBI
Cytogenetic Map	8	q32	NCBI

IP6K1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	49,724,294 - 49,786,542 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	49,724,294 - 49,786,546 (-)	Ensembl			hg38	GRCh38
GRCh37	3	49,761,727 - 49,823,975 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	49,736,732 - 49,798,977 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	49,736,731 - 49,798,977	NCBI
Celera	3	49,726,419 - 49,789,549 (-)	NCBI		Celera
Cytogenetic Map	3	p21.31	NCBI
HuRef	3	49,820,704 - 49,883,587 (-)	NCBI		HuRef
CHM1_1	3	49,713,786 - 49,776,031 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	49,753,580 - 49,816,428 (-)	NCBI		T2T-CHM13v2.0

Ip6k1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	107,879,847 - 107,925,981 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	107,879,700 - 107,925,981 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	108,002,648 - 108,048,782 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	108,002,501 - 108,048,782 (+)	Ensembl			mm10	GRCm38
MGSCv37	9	107,904,979 - 107,951,113 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	107,860,749 - 107,906,883 (+)	NCBI		MGSCv36	mm8
Celera	9	107,611,133 - 107,658,638 (+)	NCBI		Celera
Cytogenetic Map	9	F1	NCBI
cM Map	9	59.07	NCBI

Ip6k1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955532	1,625,298 - 1,644,973 (-)	Ensembl
ChiLan1.0	NW_004955532	1,625,298 - 1,644,973 (-)	NCBI	ChiLan1.0	ChiLan1.0

IP6K1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	49,710,898 - 49,772,847 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	49,715,672 - 49,740,252 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	49,656,438 - 49,718,423 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	50,892,279 - 50,954,149 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	50,892,279 - 50,954,149 (-)	Ensembl			panPan2	panpan1.1

IP6K1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	39,484,487 - 39,550,199 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	39,484,531 - 39,547,412 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	39,405,324 - 39,471,123 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	39,841,196 - 39,907,718 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	39,841,182 - 39,907,715 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	39,208,410 - 39,274,790 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	39,612,395 - 39,678,160 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	39,892,193 - 39,957,989 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ip6k1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	64,578,315 - 64,636,474 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936529	1,338,812 - 1,396,965 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936529	1,338,812 - 1,396,981 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IP6K1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	32,253,515 - 32,319,988 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	32,253,515 - 32,320,005 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	35,432,716 - 35,499,247 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IP6K1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	11,119,315 - 11,187,512 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	11,119,313 - 11,146,192 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	155,807,778 - 155,880,857 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ip6k1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	3,648,461 - 3,704,646 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	3,648,461 - 3,704,664 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ip6k1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	99,333,604 - 99,377,286 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ip6k1
311 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	410
Count of miRNA genes:	211
Interacting mature miRNAs:	285
Transcripts:	ENSRNOT00000041402
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	105462581	132782436	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	82352698	127352698	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	80768445	125768445	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	80768445	125768445	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	70041301	121080908	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	68690349	119799881	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	84192326	129192326	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	102413464	132782436	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	103375781	129871912	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	84192326	132782436	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	85348065	130348065	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	79394435	132782436	Rat
631217	Activ1	Activity QTL 1	15.9		voluntary movement trait (VT:0003491)	number of photobeam interruptions in an experimental apparatus (CMO:0001517)	8	111249511	117802327	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	98145073	122898010	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	80768445	125768445	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	80768445	125768445	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	91340911	131690273	Rat

Markers in Region

RH127749

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	108,736,738 - 108,736,923 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	116,825,613 - 116,825,797	NCBI	Rnor6.0
Rnor_5.0	8	116,179,935 - 116,180,119	UniSTS	Rnor5.0
RGSC_v3.4	8	113,316,098 - 113,316,282	UniSTS	RGSC3.4
Celera	8	108,041,451 - 108,041,635	UniSTS
RH 3.4 Map	8	1118.6	UniSTS
Cytogenetic Map	8	q32	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053316	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB049151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC128059	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211545	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000041402 ⟹ ENSRNOP00000044935

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	8	116,804,451 - 116,823,540 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000133855 ⟹ ENSRNOP00000106812

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	117,594,317 - 117,613,274 (+)	Ensembl

RefSeq Acc Id:

NM_053316 ⟹ NP_445768

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	117,594,177 - 117,613,266 (+)	NCBI
mRatBN7.2	8	108,715,572 - 108,734,666 (+)	NCBI
Rnor_6.0	8	116,804,451 - 116,823,540 (+)	NCBI
Rnor_5.0	8	116,136,279 - 116,180,474 (+)	NCBI
RGSC_v3.4	8	113,294,932 - 113,314,025 (+)	RGD
Celera	8	108,020,289 - 108,039,387 (+)	RGD

Sequence:

show sequence

GGTGGAGACCAAGGCTGCATCATTTTGACGACAGAACAATAAGCTAAGCAGACTCTGACCATTG
GCCTCCCACTAGCCAGGATCGACCTAGCTCTCCTTTTGTGGTCCATGTGCTGCATCGTCTGCTG
TCAGTGTGTAACCGGCCCCCAACGCAATGTGTGTTTGTCAAACCATGGAAGTGGGGCAGTATGG
CAAGAACGCAAGTCGGGCGGGAGACCGAGGAGTCCTCCTGGAGCCCTTTATCCATCAGGTGGGC
GGACACAGCAGCATGATGCGGTACGACGATCACACGGTGTGCAAACCTCTCATCTCTCGGGAAC
AGCGCTTCTACGAGTCTCTCCCTCCCGAAATGAAGGAATTCACCCCAGAATACAAAGGTGTGGT
TTCTGTCTGTTTTGAGGGAGACAGTGACGGTTACATCAACCTGGTAGCCTACCCTTATGTGGAG
AGTGAAACTGTAGAGCAAGACGACACACCTGAGCGGGAGCAACCTCGGCGCAAACACTCCCGCC
GGAGCCTGCATCGGTCTGGCAGTGGTAGTGACCACAAGGAGGAGAAAGCCAGCCTGTCCTTTGA
GACCTCTGAAAGCTCCCAGGAGACAAAGAGTCCAAAGGTGGAGCTGCACAGCCACTCAGATGTC
CCTTTCCAGATGCTAGACAGCAATAGCGGGCTGAGCTCTGAGAAGATCAGCTACAACCCCTGGA
GCCTGCGCTGCCACAAGCAGCAGCTGAGCCGCATGCGCTCCGAGTCCAAGGACCGAAAACTCTA
CAAGTTCCTCCTGCTTGAGAATGTGGTTCACCACTTCAAGTACCCCTGTGTGTTGGACTTGAAG
ATGGGTACCCGACAGCATGGGGATGATGCTTCAGCTGAGAAGGCAGCCCGGCAGATGAGGAAGT
GTGAGCAGAGCACATCGGCCTCGCTGGGGGTCAGGGTCTGTGGCATGCAGGTGTACCAGCTGGA
CACAGGTCATTACCTCTGTAGGAATAAGTACTATGGTCGTGGACTCTCCATCGAAGGCTTCCGC
AATGCCCTGTATCAGTACCTGCACAATGGCTTGGACCTGCGACGTGACCTTTTTGAGCCTATCC
TGAGCAAACTGCGAGGCCTCAAAGCTGTGCTGGAGCGGCAGGCCTCCTACCGCTTCTACTCCAG
TTCCCTGCTTGTCATCTATGATGGCAAGGAGTGCCGGTCTGAGCTACGTCTCAAGCACGTGGAC
ATGGGGCTCCCTGAGGTGCCACCACTCTGTGGTCCCAGCACCAGCCCTAGCAACACCAGTCTTG
AGGCTGGCCCCTCTTCTCCGCCCAAGGTGGATGTCCGCATGATTGACTTTGCACATAGCACATT
CAAGGGCTTCCGGGATGACCCCACTGTTCACGATGGGCCAGACAGAGGCTATGTGTTTGGCTTG
GAGAATCTTATCAGCATCATGGAGCAGATGCGGGATGAGAACCAGTAAGCCCAGTTCTGGGCCC
TAGGACCCCTTCCTCTCCACCCACAGGCAGGGACCATTGCTCTGAACTTGCTGTGAGGACACAG
ACTTGCTTTTAAAGGGTTATATTTCTCTTTGGTGTAAACTAAAAGAAATGTTTAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_445768	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78702	(Get FASTA)	NCBI Sequence Viewer
	BAB13737	(Get FASTA)	NCBI Sequence Viewer
	EDL77199	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000106812
GenBank Protein	Q9ESM0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445768 ⟸ NM_053316

- UniProtKB:

Q9ESM0 (UniProtKB/Swiss-Prot), A6I328 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYESLPP
EMKEFTPEYKGVVSVCFEGDSDGYINLVAYPYVESETVEQDDTPEREQPRRKHSRRSLHRSGSG
SDHKEEKASLSFETSESSQETKSPKVELHSHSDVPFQMLDSNSGLSSEKISYNPWSLRCHKQQL
SRMRSESKDRKLYKFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEKAARQMRKCEQSTSASL
GVRVCGMQVYQLDTGHYLCRNKYYGRGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKA
VLERQASYRFYSSSLLVIYDGKECRSELRLKHVDMGLPEVPPLCGPSTSPSNTSLEAGPSSPPK
VDVRMIDFAHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDENQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000044935 ⟸ ENSRNOT00000041402

Ensembl Acc Id:

ENSRNOP00000106812 ⟸ ENSRNOT00000133855

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9ESM0-F1-model_v2	AlphaFold	Q9ESM0	1-433	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71025	AgrOrtholog
BioCyc Gene	G2FUF-29162	BioCyc
BioCyc Pathway	PWY-6369 [inositol diphosphates biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-6369	BioCyc
Ensembl Genes	ENSRNOG00000019932	Ensembl
	ENSRNOG00000085966	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000133855	ENTREZGENE
Gene3D-CATH	3.30.470.160	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7132706	IMAGE-MGC_LOAD
InterPro	IPK	UniProtKB/Swiss-Prot
	IPK_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:50560	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93102	IMAGE-MGC_LOAD
NCBI Gene	50560	ENTREZGENE
PANTHER	INOSITOL HEXAKISPHOSPHATE KINASE 1	UniProtKB/Swiss-Prot
	PTHR12400	UniProtKB/Swiss-Prot
Pfam	IPK	UniProtKB/Swiss-Prot
PhenoGen	Ip6k1	PhenoGen
RatGTEx	ENSRNOG00000019932	RatGTEx
	ENSRNOG00000085966	RatGTEx
Superfamily-SCOP	SAICAR synthase-like	UniProtKB/Swiss-Prot
UniProt	A6I328	ENTREZGENE, UniProtKB/TrEMBL
	IP6K1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-02-26	Ip6k1	inositol hexakisphosphate kinase 1	Ihpk1	inositol hexaphosphate kinase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-07-09	Ihpk1	inositol hexaphosphate kinase 1			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Annotations - SMPDB

BioCyc Pathways

Send us a Message

Imported Annotations - SMPDB

BioCyc Pathways