Symbol:
Lgals3
Name:
galectin 3
RGD ID:
69356
Description:
Enables several functions, including Fc-gamma receptor I complex binding activity; IgE binding activity; and advanced glycation end-product receptor activity. Involved in several processes, including negative regulation of cell proliferation in bone marrow; positive regulation of serotonin secretion; and response to quercetin. Located in cell surface and extracellular space. Biomarker of several diseases, including acute kidney failure; attention deficit hyperactivity disorder; brain ischemia; colon cancer; and congestive heart failure. Human ortholog(s) of this gene implicated in asthma. Orthologous to human LGALS3 (galectin 3); PARTICIPATES IN Hedgehog signaling pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
35 kDa lectin; AGE-R3; carbohydrate-binding protein 35; CBP 35; CBP30; epsilon BP; gal-3; galactose-specific lectin 3; galectin-3; IgE binding protein; L-34; laminin-binding protein; lectin galactoside-binding soluble 3 protein; lectin L-29; lectin, galactose binding, soluble 3; lectin, galactoside-binding, soluble, 3; mac-2 antigen; MGC105387
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LGALS3 (galectin 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Lgals3 (lectin, galactose binding, soluble 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lgals3 (galectin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LGALS3 (galectin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LGALS3 (galectin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lgals3 (galectin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LGALS3 (galectin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LGALS3 (galectin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lgals3 (galectin 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GPR52 (G protein-coupled receptor 52) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
LGALS3 (galectin 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Lgals3 (lectin, galactose binding, soluble 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
lgals3b (lectin, galactoside binding soluble 3b)
Alliance
DIOPT (OMA|OrthoInspector|PANTHER)
Danio rerio (zebrafish):
lgals3a (lectin, galactoside binding soluble 3a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG13950
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
CG5335
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F46A8.3
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F46A8.4
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F49F1.10
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F49F1.11
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
lec-8
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
lec-7
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F46A8.8
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F46A8.5
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F49F1.18
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F49F1.9
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F40H6.5
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
C27C7.5
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
pqn-84
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
lgals3
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 23,099,795 - 23,111,731 (+) NCBI GRCr8 mRatBN7.2 15 20,620,083 - 20,632,019 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 20,607,692 - 20,632,025 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 23,400,729 - 23,412,663 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 24,358,692 - 24,370,626 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 22,609,201 - 22,621,133 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 24,153,602 - 24,165,537 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 24,141,651 - 24,165,537 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 28,094,344 - 28,106,281 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 23,327,071 - 23,339,006 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 15 21,014,742 - 21,026,522 (+) NCBI Celera Cytogenetic Map 15 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lgals3 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of LGALS3 mRNA] CTD PMID:31150632 Lgals3 Rat (1->4)-beta-D-glucan multiple interactions ISO Lgals3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of LGALS3 mRNA CTD PMID:36331819 Lgals3 Rat 1,1-dichloroethene increases expression ISO Lgals3 (Mus musculus) 6480464 vinylidene chloride results in increased expression of LGALS3 mRNA CTD PMID:26682919 Lgals3 Rat 1,4-dichlorobenzene increases expression ISO Lgals3 (Mus musculus) 6480464 4-dichlorobenzene results in increased expression of LGALS3 mRNA CTD PMID:26975756 Lgals3 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of LGALS3 mRNA CTD PMID:17522070 more ... Lgals3 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of LGALS3 mRNA CTD PMID:17557909 Lgals3 Rat 17beta-estradiol affects expression ISO Lgals3 (Mus musculus) 6480464 Estradiol affects the expression of LGALS3 mRNA CTD PMID:15598610 Lgals3 Rat 17beta-estradiol multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of LGALS3 mRNA and [Estradiol co-treated with Progesterone] results in decreased expression of LGALS3 mRNA CTD PMID:20660070 and PMID:20823114 Lgals3 Rat 17beta-estradiol increases expression ISO Lgals3 (Mus musculus) 6480464 Estradiol results in increased expression of LGALS3 mRNA CTD PMID:15289156 Lgals3 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Lgals3 (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Lgals3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Lgals3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of LGALS3 mRNA CTD PMID:20159946 Lgals3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Lgals3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of LGALS3 mRNA CTD PMID:17035482 more ... Lgals3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO LGALS3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of LGALS3 mRNA CTD PMID:11489354 more ... Lgals3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Lgals3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of LGALS3 mRNA CTD PMID:21570461 more ... Lgals3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of LGALS3 mRNA CTD PMID:20959002 more ... Lgals3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of LGALS3 mRNA CTD PMID:22298810 and PMID:34747641 Lgals3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO LGALS3 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Lgals3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Lgals3 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Lgals3 Rat 2,6-dimethoxyphenol multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of LGALS3 protein CTD PMID:38598786 Lgals3 Rat 2-hydroxypropanoic acid increases expression ISO LGALS3 (Homo sapiens) 6480464 Lactic Acid results in increased expression of LGALS3 mRNA CTD PMID:30851411 Lgals3 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of LGALS3 mRNA CTD PMID:15890375 Lgals3 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:20959002 Lgals3 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Lgals3 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO LGALS3 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of LGALS3 protein CTD PMID:31675489 Lgals3 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of LGALS3 mRNA CTD PMID:28522335 Lgals3 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of LGALS3 protein CTD PMID:34915118 Lgals3 Rat 3-methylcholanthrene increases expression ISO Lgals3 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of LGALS3 mRNA CTD PMID:20713471 Lgals3 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of LGALS3 mRNA CTD PMID:19162173 Lgals3 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of LGALS3 mRNA CTD PMID:25380136 Lgals3 Rat 4,4'-sulfonyldiphenol decreases expression ISO LGALS3 (Homo sapiens) 6480464 bisphenol S results in decreased expression of LGALS3 mRNA CTD PMID:25912373 Lgals3 Rat 4,4'-sulfonyldiphenol increases expression ISO LGALS3 (Homo sapiens) 6480464 bisphenol S results in increased expression of LGALS3 protein CTD PMID:34186270 Lgals3 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Lgals3 (Mus musculus) 6480464 bisphenol S results in decreased methylation of LGALS3 exon CTD PMID:33297965 Lgals3 Rat 4,4'-sulfonyldiphenol decreases expression ISO Lgals3 (Mus musculus) 6480464 bisphenol S results in decreased expression of LGALS3 mRNA CTD PMID:39298647 Lgals3 Rat 4,4'-sulfonyldiphenol increases expression ISO Lgals3 (Mus musculus) 6480464 bisphenol S results in increased expression of LGALS3 mRNA CTD PMID:30951980 Lgals3 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of LGALS3 mRNA CTD PMID:15890375 Lgals3 Rat 4-hydroxyphenyl retinamide decreases expression ISO Lgals3 (Mus musculus) 6480464 Fenretinide results in decreased expression of LGALS3 mRNA CTD PMID:28973697 Lgals3 Rat 5-aza-2'-deoxycytidine increases expression ISO LGALS3 (Homo sapiens) 6480464 Decitabine results in increased expression of LGALS3 mRNA CTD PMID:19194470 Lgals3 Rat 5-fluorouracil affects response to substance ISO LGALS3 (Homo sapiens) 6480464 LGALS3 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Lgals3 Rat 5-fluorouracil multiple interactions EXP 150530464 5-fluorouracil inhibits the reaction [N-methyl-N-nitrosourea increases expression of Lgals3 protein in serum] RGD Lgals3 Rat 5-fluorouracil decreases response to substance ISO LGALS3 (Homo sapiens) 6480464 LGALS3 protein mutant form results in decreased susceptibility to Fluorouracil CTD PMID:21750908 Lgals3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of LGALS3 mRNA CTD PMID:24780913 Lgals3 Rat 7,12-dimethyltetraphene affects expression ISO Lgals3 (Mus musculus) 6480464 9 more ... CTD PMID:21785161 Lgals3 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of LGALS3 mRNA CTD PMID:31881176 Lgals3 Rat actinomycin D multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of LGALS3 protein and Dactinomycin inhibits the reaction [2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in increased expression of LGALS3 protein] CTD PMID:21821001 and PMID:38460933 Lgals3 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of LGALS3 mRNA CTD PMID:15890375 Lgals3 Rat aflatoxin B1 increases expression ISO LGALS3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of LGALS3 mRNA CTD PMID:27153756 Lgals3 Rat aflatoxin B1 decreases expression ISO Lgals3 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of LGALS3 mRNA CTD PMID:19770486 Lgals3 Rat all-trans-retinoic acid decreases expression ISO LGALS3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of LGALS3 mRNA CTD PMID:12875902 Lgals3 Rat all-trans-retinoic acid increases expression ISO LGALS3 (Homo sapiens) 6480464 Tretinoin results in increased expression of LGALS3 mRNA CTD PMID:23724009 Lgals3 Rat all-trans-retinoic acid decreases expression ISO Lgals3 (Mus musculus) 6480464 Tretinoin results in decreased expression of LGALS3 mRNA CTD PMID:16604517 Lgals3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of LGALS3 mRNA CTD PMID:16483693 Lgals3 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of LGALS3 mRNA CTD PMID:30779732 Lgals3 Rat aristolochic acid A increases expression ISO LGALS3 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of LGALS3 protein CTD PMID:33212167 Lgals3 Rat arsenite(3-) decreases expression ISO Lgals3 (Mus musculus) 6480464 arsenite results in decreased expression of LGALS3 protein CTD PMID:37955338 Lgals3 Rat arsenite(3-) multiple interactions ISO LGALS3 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to LGALS3 protein] and arsenite promotes the reaction [G3BP1 protein binds to LGALS3 mRNA] CTD PMID:32406909 Lgals3 Rat arsenous acid increases expression ISO LGALS3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of LGALS3 mRNA CTD PMID:20458559 Lgals3 Rat benzo[a]pyrene increases expression ISO Lgals3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of LGALS3 mRNA CTD PMID:22228805 and PMID:23735875 Lgals3 Rat benzo[a]pyrene increases methylation ISO LGALS3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of LGALS3 5' UTR CTD PMID:27901495 Lgals3 Rat benzo[a]pyrene affects methylation ISO LGALS3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of LGALS3 promoter CTD PMID:27901495 Lgals3 Rat benzo[a]pyrene increases expression ISO LGALS3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of LGALS3 mRNA and Benzo(a)pyrene results in increased expression of LGALS3 protein CTD PMID:16269432 more ... Lgals3 Rat benzo[b]fluoranthene increases expression ISO LGALS3 (Homo sapiens) 6480464 benzo(b)fluoranthene results in increased expression of LGALS3 mRNA CTD PMID:16269432 Lgals3 Rat beta-lapachone increases expression ISO LGALS3 (Homo sapiens) 6480464 beta-lapachone results in increased expression of LGALS3 mRNA CTD PMID:38218311 Lgals3 Rat beta-naphthoflavone increases expression ISO LGALS3 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of LGALS3 mRNA CTD PMID:19737606 Lgals3 Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of LGALS3 mRNA CTD PMID:16648578 Lgals3 Rat bezafibrate increases expression ISO Lgals3 (Mus musculus) 6480464 Bezafibrate results in increased expression of LGALS3 mRNA CTD PMID:17118139 Lgals3 Rat bis(2-chloroethyl) sulfide increases expression EXP 6480464 Mustard Gas results in increased expression of LGALS3 protein CTD PMID:33002157 Lgals3 Rat bis(2-ethylhexyl) phthalate increases expression ISO LGALS3 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of LGALS3 mRNA CTD PMID:31163220 Lgals3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of LGALS3 mRNA CTD PMID:25181051 Lgals3 Rat bisphenol A decreases expression ISO LGALS3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of LGALS3 protein CTD PMID:34186270 Lgals3 Rat bisphenol A increases expression ISO LGALS3 (Homo sapiens) 6480464 bisphenol A results in increased expression of LGALS3 protein CTD PMID:33376534 and PMID:37567409 Lgals3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of LGALS3 mRNA CTD PMID:32145629 Lgals3 Rat bisphenol A affects expression ISO LGALS3 (Homo sapiens) 6480464 bisphenol A affects the expression of LGALS3 mRNA CTD PMID:30903817 Lgals3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of LGALS3 gene CTD PMID:28505145 Lgals3 Rat bisphenol AF increases expression ISO LGALS3 (Homo sapiens) 6480464 bisphenol AF results in increased expression of LGALS3 protein CTD PMID:34186270 Lgals3 Rat bisphenol F increases expression ISO Lgals3 (Mus musculus) 6480464 bisphenol F results in increased expression of LGALS3 mRNA CTD PMID:30951980 Lgals3 Rat bleomycin A2 increases expression ISO Lgals3 (Mus musculus) 6480464 Bleomycin results in increased expression of LGALS3 protein CTD PMID:26526764 Lgals3 Rat bleomycin A2 multiple interactions ISO Lgals3 (Mus musculus) 6480464 NOS2 protein affects the reaction [Bleomycin results in increased expression of LGALS3 protein] CTD PMID:26526764 Lgals3 Rat bucladesine multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of LGALS3 mRNA CTD PMID:20823114 Lgals3 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of LGALS3 mRNA CTD PMID:24136188 Lgals3 Rat cadmium dichloride affects expression EXP 6480464 Cadmium Chloride affects the expression of LGALS3 mRNA CTD PMID:22110744 Lgals3 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of LGALS3 mRNA CTD PMID:25993096 Lgals3 Rat calcitriol decreases expression ISO LGALS3 (Homo sapiens) 6480464 Calcitriol results in decreased expression of LGALS3 mRNA CTD PMID:12875902 Lgals3 Rat calyculin a increases expression ISO Lgals3 (Mus musculus) 6480464 calyculin A results in increased expression of LGALS3 mRNA CTD PMID:25270620 Lgals3 Rat carbon nanotube affects expression ISO Lgals3 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of LGALS3 mRNA CTD PMID:23845593 Lgals3 Rat carbon nanotube increases expression ISO Lgals3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:27106021 Lgals3 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of LGALS3 mRNA CTD PMID:18500788 Lgals3 Rat CGP 52608 multiple interactions ISO LGALS3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to LGALS3 gene] CTD PMID:28238834 Lgals3 Rat chloroform increases expression EXP 6480464 Chloroform results in increased expression of LGALS3 mRNA CTD PMID:17522070 Lgals3 Rat choline multiple interactions ISO Lgals3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LGALS3 mRNA CTD PMID:20938992 Lgals3 Rat ciglitazone multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [ciglitazone binds to PPARG protein] which results in increased expression of LGALS3 mRNA CTD PMID:16197558 Lgals3 Rat cisplatin multiple interactions ISO LGALS3 (Homo sapiens) 6480464 4-benzyl-2-methyl-1 more ... CTD PMID:21368866 and PMID:21821001 Lgals3 Rat cisplatin multiple interactions EXP 6480464 [citrus pectin co-treated with Cisplatin] results in increased localization of LGALS3 protein CTD PMID:38522819 Lgals3 Rat cisplatin decreases response to substance ISO LGALS3 (Homo sapiens) 6480464 GAL3 protein results in decreased susceptibility to Cisplatin more ... CTD PMID:21368866 more ... Lgals3 Rat cisplatin increases expression ISO LGALS3 (Homo sapiens) 6480464 Cisplatin results in increased expression of LGALS3 mRNA and Cisplatin results in increased expression of LGALS3 protein CTD PMID:21821001 and PMID:27392435 Lgals3 Rat clofibrate increases expression ISO Lgals3 (Mus musculus) 6480464 Clofibrate results in increased expression of LGALS3 mRNA CTD PMID:17585979 Lgals3 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of LGALS3 mRNA CTD PMID:24386269 Lgals3 Rat copper(II) sulfate increases expression ISO LGALS3 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of LGALS3 mRNA CTD PMID:19549813 Lgals3 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of LGALS3 mRNA CTD PMID:26577399 and PMID:27523638 Lgals3 Rat cycloheximide multiple interactions ISO LGALS3 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in increased expression of LGALS3 protein] CTD PMID:21821001 Lgals3 Rat cyclosporin A increases expression ISO LGALS3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of LGALS3 mRNA CTD PMID:25562108 and PMID:27989131 Lgals3 Rat decabromodiphenyl ether decreases expression ISO LGALS3 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of LGALS3 protein CTD PMID:31675489 Lgals3 Rat dexamethasone multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [GCS-100 co-treated with Dexamethasone] results in decreased expression of LGALS3 protein CTD PMID:16166312 Lgals3 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of LGALS3 mRNA CTD PMID:17522070 Lgals3 Rat diarsenic trioxide increases expression ISO LGALS3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of LGALS3 mRNA CTD PMID:20458559 Lgals3 Rat dibenz[a,h]anthracene increases expression ISO LGALS3 (Homo sapiens) 6480464 1 more ... CTD PMID:16269432 Lgals3 Rat dibenzo[a,l]pyrene increases expression ISO LGALS3 (Homo sapiens) 6480464 dibenzo(a and l)pyrene results in increased expression of LGALS3 protein CTD PMID:18495319 Lgals3 Rat Dibutyl phosphate affects expression ISO LGALS3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of LGALS3 mRNA CTD PMID:37042841 Lgals3 Rat diclofenac increases expression ISO Lgals3 (Mus musculus) 6480464 Diclofenac results in increased expression of LGALS3 mRNA CTD PMID:26934552 Lgals3 Rat dicrotophos decreases expression ISO LGALS3 (Homo sapiens) 6480464 dicrotophos results in decreased expression of LGALS3 mRNA CTD PMID:28302478 Lgals3 Rat diethylstilbestrol increases expression ISO Lgals3 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of LGALS3 mRNA CTD PMID:15289156 Lgals3 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of LGALS3 mRNA CTD PMID:15890375 Lgals3 Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of LGALS3 mRNA CTD PMID:16122865 Lgals3 Rat dioxygen increases expression ISO Lgals3 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of LGALS3 mRNA CTD PMID:17193925 Lgals3 Rat dioxygen multiple interactions ISO Lgals3 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of LGALS3 mRNA and [Oxygen deficiency co-treated with Blood Glucose deficiency] results in increased expression of LGALS3 mRNA CTD PMID:19640911 and PMID:30529165 Lgals3 Rat dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of LGALS3 protein and Oxygen results in increased expression of LGALS3 mRNA CTD PMID:22911455 and PMID:32003113 Lgals3 Rat diquat increases expression ISO Lgals3 (Mus musculus) 6480464 Diquat results in increased expression of LGALS3 mRNA CTD PMID:36851058 Lgals3 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of LGALS3 mRNA CTD PMID:21551480 Lgals3 Rat dorsomorphin multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Lgals3 Rat doxorubicin decreases response to substance ISO LGALS3 (Homo sapiens) 6480464 LGALS3 mRNA results in decreased susceptibility to Doxorubicin CTD PMID:16322897 Lgals3 Rat doxorubicin increases expression ISO Lgals3 (Mus musculus) 6480464 Doxorubicin results in increased expression of LGALS3 mRNA CTD PMID:36227756 Lgals3 Rat doxorubicin increases expression ISO LGALS3 (Homo sapiens) 6480464 Doxorubicin results in increased expression of LGALS3 mRNA CTD PMID:29803840 Lgals3 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of LGALS3 mRNA CTD PMID:29391264 Lgals3 Rat entinostat increases expression ISO LGALS3 (Homo sapiens) 6480464 entinostat results in increased expression of LGALS3 mRNA CTD PMID:26272509 Lgals3 Rat entinostat multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LGALS3 mRNA CTD PMID:27188386 Lgals3 Rat erythromycin estolate increases expression EXP 6480464 Erythromycin Estolate results in increased expression of LGALS3 mRNA CTD PMID:17522070 Lgals3 Rat etoposide affects response to substance ISO LGALS3 (Homo sapiens) 6480464 LGALS3 protein affects the susceptibility to Etoposide CTD PMID:16217747 Lgals3 Rat fenamidone increases expression ISO Lgals3 (Mus musculus) 6480464 fenamidone results in increased expression of LGALS3 mRNA CTD PMID:27029645 Lgals3 Rat ferric oxide increases expression EXP 6480464 ferric oxide analog results in increased expression of LGALS3 mRNA CTD PMID:38615722 Lgals3 Rat flurbiprofen increases expression ISO Lgals3 (Mus musculus) 6480464 Flurbiprofen results in increased expression of LGALS3 mRNA CTD PMID:16949054 Lgals3 Rat folic acid increases expression EXP 6480464 Folic Acid results in increased expression of LGALS3 mRNA CTD PMID:10980121 Lgals3 Rat folic acid multiple interactions ISO Lgals3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LGALS3 mRNA CTD PMID:20938992 Lgals3 Rat furfural multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of LGALS3 protein CTD PMID:38598786 Lgals3 Rat genistein increases expression ISO Lgals3 (Mus musculus) 6480464 Genistein results in increased expression of LGALS3 mRNA CTD PMID:15289156 Lgals3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of LGALS3 mRNA CTD PMID:33387578 Lgals3 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of LGALS3 mRNA CTD PMID:24136188 Lgals3 Rat isoprenaline increases expression ISO Lgals3 (Mus musculus) 6480464 Isoproterenol results in increased expression of LGALS3 mRNA CTD PMID:20003209 Lgals3 Rat ivermectin decreases expression ISO LGALS3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of LGALS3 protein CTD PMID:32959892 Lgals3 Rat L-ascorbic acid increases expression EXP 6480464 Ascorbic Acid results in increased expression of LGALS3 mRNA CTD PMID:15372504 Lgals3 Rat L-methionine multiple interactions ISO Lgals3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LGALS3 mRNA CTD PMID:20938992 Lgals3 Rat lactose affects binding ISO LGALS3 (Homo sapiens) 6480464 Lactose binds to LGALS3 protein CTD PMID:17385862 Lgals3 Rat leflunomide increases expression ISO LGALS3 (Homo sapiens) 6480464 leflunomide results in increased expression of LGALS3 mRNA CTD PMID:28988120 and PMID:29427785 Lgals3 Rat LY294002 multiple interactions ISO LGALS3 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in increased expression of and affects the localization of LGALS3 protein more ... CTD PMID:21821001 Lgals3 Rat LY294002 decreases response to substance ISO LGALS3 (Homo sapiens) 6480464 LGALS3 results in decreased susceptibility to 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one CTD PMID:21821001 Lgals3 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of LGALS3 mRNA CTD PMID:28801915 Lgals3 Rat medroxyprogesterone acetate multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of LGALS3 mRNA CTD PMID:20823114 Lgals3 Rat mercury dibromide increases expression ISO LGALS3 (Homo sapiens) 6480464 mercuric bromide results in increased expression of LGALS3 mRNA CTD PMID:26272509 Lgals3 Rat mercury dibromide multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LGALS3 mRNA CTD PMID:27188386 Lgals3 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of LGALS3 mRNA CTD PMID:15890375 Lgals3 Rat methimazole increases expression ISO LGALS3 (Homo sapiens) 6480464 Methimazole results in increased expression of LGALS3 mRNA CTD PMID:20144635 Lgals3 Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of LGALS3 gene CTD PMID:23303685 Lgals3 Rat methylmercury chloride decreases expression ISO LGALS3 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of LGALS3 mRNA CTD PMID:23179753 and PMID:34089799 Lgals3 Rat methylmercury chloride increases expression ISO LGALS3 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of LGALS3 mRNA CTD PMID:28001369 Lgals3 Rat microcystin-LR increases expression ISO Lgals3 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of LGALS3 mRNA CTD PMID:17654400 Lgals3 Rat mifepristone decreases expression EXP 6480464 Mifepristone results in decreased expression of LGALS3 mRNA CTD PMID:25972201 Lgals3 Rat mitomycin C affects response to substance ISO LGALS3 (Homo sapiens) 6480464 LGALS3 protein affects the susceptibility to Mitomycin CTD PMID:16217747 Lgals3 Rat monocrotaline multiple interactions EXP 6480464 [Monocrotaline co-treated with LGALS3 protein] inhibits the reaction [[Monocrotaline co-treated with TGFB1] results in decreased expression of MMP9 protein] more ... CTD PMID:27870162 Lgals3 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of LGALS3 gene CTD PMID:33148267 Lgals3 Rat N-acetylsphingosine increases expression ISO LGALS3 (Homo sapiens) 6480464 N-acetylsphingosine results in increased expression of LGALS3 protein CTD PMID:21821001 Lgals3 Rat N-acetylsphingosine decreases response to substance ISO LGALS3 (Homo sapiens) 6480464 LGALS3 results in decreased susceptibility to N-acetylsphingosine CTD PMID:21821001 Lgals3 Rat N-acetylsphingosine multiple interactions ISO LGALS3 (Homo sapiens) 6480464 4-benzyl-2-methyl-1 more ... CTD PMID:21821001 Lgals3 Rat N-ethyl-N-nitrosourea increases expression EXP 6480464 Ethylnitrosourea results in increased expression of LGALS3 mRNA CTD PMID:15954086 Lgals3 Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO Lgals3 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Tetradecanoylphorbol Acetate] results in increased expression of LGALS3 mRNA CTD PMID:19840844 Lgals3 Rat N-methyl-N-nitrosourea decreases expression ISO Lgals3 (Mus musculus) 6480464 Methylnitrosourea results in decreased expression of LGALS3 mRNA CTD PMID:25270620 Lgals3 Rat N-methyl-N-nitrosourea increases expression EXP 150530464 N-methyl-N-nitrosourea increases expression of Lgals3 protein in serum RGD Lgals3 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of LGALS3 mRNA CTD PMID:19638242 Lgals3 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of LGALS3 mRNA CTD PMID:28943392 Lgals3 Rat N-nitrosodiethylamine multiple interactions ISO Lgals3 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of LGALS3 mRNA CTD PMID:24535843 Lgals3 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of LGALS3 mRNA CTD PMID:15890375 and PMID:25380136 Lgals3 Rat N-nitrosodimethylamine increases expression ISO LGALS3 (Homo sapiens) 6480464 Dimethylnitrosamine results in increased expression of LGALS3 mRNA CTD PMID:17547211 Lgals3 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of LGALS3 mRNA CTD PMID:19716841 Lgals3 Rat naloxone increases expression EXP 6480464 Naloxone results in increased expression of LGALS3 mRNA CTD PMID:17522070 Lgals3 Rat nickel atom increases expression ISO Lgals3 (Mus musculus) 6480464 Nickel results in increased expression of LGALS3 mRNA CTD PMID:12540486 Lgals3 Rat nickel subsulfide increases expression EXP 6480464 nickel subsulfide results in increased expression of LGALS3 mRNA CTD PMID:21086188 Lgals3 Rat nickel sulfate affects expression ISO Lgals3 (Mus musculus) 6480464 nickel sulfate affects the expression of LGALS3 mRNA CTD PMID:12718980 Lgals3 Rat nickel sulfate decreases expression ISO LGALS3 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of LGALS3 mRNA CTD PMID:18651567 Lgals3 Rat niclosamide increases expression ISO LGALS3 (Homo sapiens) 6480464 Niclosamide results in increased expression of LGALS3 mRNA CTD PMID:36318118 Lgals3 Rat Nonylphenol increases expression ISO LGALS3 (Homo sapiens) 6480464 nonylphenol results in increased expression of LGALS3 protein CTD PMID:16054331 Lgals3 Rat Nutlin-3 multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of LGALS3 protein CTD PMID:38460933 Lgals3 Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of LGALS3 mRNA CTD PMID:38301995 Lgals3 Rat oxycodone decreases expression EXP 6480464 Oxycodone results in decreased expression of LGALS3 mRNA CTD PMID:23439660 Lgals3 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of LGALS3 protein CTD PMID:22727909 Lgals3 Rat ozone multiple interactions ISO Lgals3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of LGALS3 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of LGALS3 mRNA CTD PMID:34911549 Lgals3 Rat panobinostat increases expression ISO LGALS3 (Homo sapiens) 6480464 panobinostat results in increased expression of LGALS3 mRNA CTD PMID:26272509 Lgals3 Rat panobinostat multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LGALS3 mRNA CTD PMID:27188386 Lgals3 Rat paracetamol affects expression ISO Lgals3 (Mus musculus) 6480464 Acetaminophen affects the expression of LGALS3 mRNA CTD PMID:17562736 Lgals3 Rat paracetamol decreases expression ISO LGALS3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of LGALS3 mRNA CTD PMID:26690555 Lgals3 Rat paracetamol affects response to substance ISO Lgals3 (Mus musculus) 6480464 LGALS3 protein affects the susceptibility to Acetaminophen CTD PMID:22461450 Lgals3 Rat paracetamol multiple interactions ISO Lgals3 (Mus musculus) 6480464 LGALS3 protein affects the reaction [Acetaminophen results in increased expression of CCL20 mRNA] more ... CTD PMID:22461450 Lgals3 Rat paracetamol increases expression ISO Lgals3 (Mus musculus) 6480464 Acetaminophen results in increased expression of LGALS3 mRNA and Acetaminophen results in increased expression of LGALS3 protein CTD PMID:22461450 and PMID:34724096 Lgals3 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of LGALS3 mRNA and Paraquat results in increased expression of LGALS3 protein CTD PMID:24521700 and PMID:32680482 Lgals3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Lgals3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of LGALS3 mRNA CTD PMID:36331819 Lgals3 Rat perfluorooctanoic acid increases expression ISO LGALS3 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of LGALS3 protein CTD PMID:26879310 Lgals3 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of LGALS3 gene CTD PMID:33148267 Lgals3 Rat phenacetin increases expression EXP 6480464 Phenacetin results in increased expression of LGALS3 mRNA CTD PMID:17082564 and PMID:17698508 Lgals3 Rat phenobarbital multiple interactions ISO Lgals3 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of LGALS3 mRNA and NR1I3 protein affects the reaction [Phenobarbital results in increased expression of LGALS3 mRNA] CTD PMID:19482888 and PMID:24535843 Lgals3 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of LGALS3 mRNA CTD PMID:19162173 Lgals3 Rat phenobarbital increases expression ISO Lgals3 (Mus musculus) 6480464 Phenobarbital results in increased expression of LGALS3 mRNA CTD PMID:19482888 Lgals3 Rat phenylhydrazine increases expression EXP 6480464 phenylhydrazine results in increased expression of LGALS3 mRNA CTD PMID:17082564 and PMID:17698508 Lgals3 Rat phenylmercury acetate increases expression ISO LGALS3 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of LGALS3 mRNA CTD PMID:26272509 Lgals3 Rat phenylmercury acetate multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LGALS3 mRNA CTD PMID:27188386 Lgals3 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Lgals3 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Tetradecanoylphorbol Acetate] results in increased expression of LGALS3 mRNA CTD PMID:19840844 Lgals3 Rat phosgene affects expression ISO Lgals3 (Mus musculus) 6480464 Phosgene affects the expression of LGALS3 mRNA CTD PMID:16300373 Lgals3 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of LGALS3 mRNA CTD PMID:15890375 Lgals3 Rat pirinixic acid multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of LGALS3 mRNA CTD PMID:19710929 Lgals3 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of LGALS3 mRNA CTD PMID:15890375 Lgals3 Rat pirinixic acid increases expression ISO Lgals3 (Mus musculus) 6480464 pirinixic acid results in increased expression of LGALS3 mRNA CTD PMID:17118139 Lgals3 Rat potassium dichromate increases expression ISO LGALS3 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of LGALS3 protein CTD PMID:23718831 Lgals3 Rat progesterone affects metabolic processing ISO Lgals3 (Mus musculus) 6480464 LGALS3 protein affects the metabolism of Progesterone CTD PMID:17242467 Lgals3 Rat progesterone multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of LGALS3 mRNA CTD PMID:20660070 Lgals3 Rat quercetin increases expression ISO LGALS3 (Homo sapiens) 6480464 Quercetin results in increased expression of LGALS3 mRNA CTD PMID:21632981 Lgals3 Rat quercetin multiple interactions EXP 150530464 Quercetin inhibits the reaction [N-methyl-N-nitrosourea increases expression of Lgals3 protein in serum] RGD Lgals3 Rat quinolin-8-ol decreases expression ISO LGALS3 (Homo sapiens) 6480464 Oxyquinoline results in decreased expression of LGALS3 mRNA CTD PMID:21632981 Lgals3 Rat quinoline increases expression ISO LGALS3 (Homo sapiens) 6480464 quinoline analog results in increased expression of LGALS3 protein CTD PMID:18645022 Lgals3 Rat rac-lactic acid increases expression ISO LGALS3 (Homo sapiens) 6480464 Lactic Acid results in increased expression of LGALS3 mRNA CTD PMID:30851411 Lgals3 Rat reactive oxygen species increases abundance ISO LGALS3 (Homo sapiens) 6480464 LGALS3 protein results in increased abundance of Reactive Oxygen Species CTD PMID:34894372 Lgals3 Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of LGALS3 mRNA CTD PMID:25905778 Lgals3 Rat resveratrol multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of LGALS3 mRNA CTD PMID:25905778 Lgals3 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of LGALS3 mRNA CTD PMID:27900601 Lgals3 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO LGALS3 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of LGALS3 mRNA CTD PMID:36336211 and PMID:37544576 Lgals3 Rat SB 431542 multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Lgals3 Rat silicon atom multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [Silicon Dioxide results in increased abundance of Silicon] which results in increased expression of LGALS3 protein more ... CTD PMID:39353502 Lgals3 Rat silicon atom multiple interactions ISO Lgals3 (Mus musculus) 6480464 [Silicon Dioxide results in increased abundance of Silicon] which results in increased expression of LGALS3 protein CTD PMID:39353502 Lgals3 Rat silicon dioxide increases expression ISO Lgals3 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of LGALS3 mRNA and Silicon Dioxide results in increased expression of LGALS3 protein CTD PMID:23221170 more ... Lgals3 Rat silicon dioxide multiple interactions ISO Lgals3 (Mus musculus) 6480464 [Silicon Dioxide results in increased abundance of Silicon] which results in increased expression of LGALS3 protein CTD PMID:39353502 Lgals3 Rat silicon dioxide increases expression ISO LGALS3 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of LGALS3 protein CTD PMID:36223831 Lgals3 Rat silicon dioxide multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [Silicon Dioxide results in increased abundance of Silicon] which results in increased expression of LGALS3 protein more ... CTD PMID:39353502 Lgals3 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of LGALS3 mRNA CTD PMID:21602193 and PMID:22431001 Lgals3 Rat sodium arsenite decreases expression ISO Lgals3 (Mus musculus) 6480464 sodium arsenite results in decreased expression of LGALS3 protein CTD PMID:29044176 Lgals3 Rat sodium chloride multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of LGALS3 protein more ... CTD PMID:38598786 Lgals3 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of LGALS3 mRNA CTD PMID:25993096 Lgals3 Rat sodium fluoride decreases expression ISO Lgals3 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of LGALS3 protein CTD PMID:28918527 Lgals3 Rat streptozocin multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of LGALS3 mRNA and vanadyl sulfate inhibits the reaction [Streptozocin results in increased expression of LGALS3 mRNA] CTD PMID:16684804 and PMID:25905778 Lgals3 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of LGALS3 mRNA CTD PMID:16684804 Lgals3 Rat sulindac multiple interactions ISO LGALS3 (Homo sapiens) 6480464 Sulindac inhibits the reaction [CDKN1A protein results in increased expression of LGALS3 mRNA] CTD PMID:15190207 Lgals3 Rat sunitinib decreases expression ISO LGALS3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of LGALS3 mRNA CTD PMID:31533062 Lgals3 Rat tamoxifen affects expression ISO LGALS3 (Homo sapiens) 6480464 Tamoxifen affects the expression of LGALS3 mRNA CTD PMID:14699072 Lgals3 Rat temozolomide decreases expression ISO LGALS3 (Homo sapiens) 6480464 Temozolomide results in decreased expression of LGALS3 mRNA CTD PMID:31758290 Lgals3 Rat testosterone increases expression ISO Lgals3 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of LGALS3 mRNA CTD PMID:33848595 Lgals3 Rat testosterone decreases expression ISO LGALS3 (Homo sapiens) 6480464 Testosterone results in decreased expression of LGALS3 mRNA CTD PMID:33359661 Lgals3 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of LGALS3 mRNA and Carbon Tetrachloride results in increased expression of LGALS3 protein CTD PMID:12629582 more ... Lgals3 Rat tetrachloromethane decreases expression ISO Lgals3 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of LGALS3 protein CTD PMID:29044176 Lgals3 Rat tetrachloromethane multiple interactions EXP 6480464 Carbon Tetrachloride promotes the reaction [PURB protein binds to LGALS3 promoter] and schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of LGALS3 mRNA] CTD PMID:16309856 and PMID:31150632 Lgals3 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of LGALS3 mRNA CTD PMID:12734012 Lgals3 Rat tetrachloromethane multiple interactions ISO Lgals3 (Mus musculus) 6480464 LGALS3 gene mutant form inhibits the reaction [Carbon Tetrachloride results in increased expression of ACTA2 mRNA] more ... CTD PMID:16549783 and PMID:23798564 Lgals3 Rat tetrachloromethane affects expression ISO Lgals3 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of LGALS3 mRNA CTD PMID:17484886 Lgals3 Rat tetrachloromethane increases expression ISO Lgals3 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of LGALS3 mRNA and Carbon Tetrachloride results in increased expression of LGALS3 protein CTD PMID:16549783 more ... Lgals3 Rat tetracycline increases expression EXP 6480464 Tetracycline results in increased expression of LGALS3 mRNA CTD PMID:17522070 Lgals3 Rat theophylline increases expression EXP 6480464 Theophylline results in increased expression of LGALS3 mRNA CTD PMID:17522070 Lgals3 Rat thioacetamide multiple interactions ISO Lgals3 (Mus musculus) 6480464 MGAT5 protein affects the reaction [Thioacetamide results in increased expression of LGALS3 mRNA] CTD PMID:23798564 Lgals3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of LGALS3 mRNA CTD PMID:34492290 Lgals3 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of LGALS3 mRNA CTD PMID:28943392 Lgals3 Rat thioacetamide increases expression ISO Lgals3 (Mus musculus) 6480464 Thioacetamide results in increased expression of LGALS3 mRNA CTD PMID:23798564 Lgals3 Rat titanium dioxide increases expression ISO Lgals3 (Mus musculus) 6480464 titanium dioxide results in increased expression of LGALS3 mRNA CTD PMID:23557971 and PMID:27760801 Lgals3 Rat titanium dioxide decreases methylation ISO Lgals3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of LGALS3 gene CTD PMID:35295148 Lgals3 Rat tremolite asbestos increases expression ISO Lgals3 (Mus musculus) 6480464 tremolite results in increased expression of LGALS3 mRNA CTD PMID:29279043 Lgals3 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of LGALS3 gene CTD PMID:27618143 Lgals3 Rat trichostatin A increases expression ISO LGALS3 (Homo sapiens) 6480464 trichostatin A results in increased expression of LGALS3 mRNA CTD PMID:24935251 and PMID:26272509 Lgals3 Rat trichostatin A multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LGALS3 mRNA CTD PMID:27188386 Lgals3 Rat triclosan increases expression ISO LGALS3 (Homo sapiens) 6480464 Triclosan results in increased expression of LGALS3 mRNA CTD PMID:30510588 Lgals3 Rat triphenyl phosphate affects expression ISO LGALS3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of LGALS3 mRNA CTD PMID:37042841 Lgals3 Rat tris(2-butoxyethyl) phosphate affects expression ISO LGALS3 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of LGALS3 mRNA CTD PMID:29024780 Lgals3 Rat tungsten decreases expression ISO Lgals3 (Mus musculus) 6480464 Tungsten results in decreased expression of LGALS3 mRNA CTD PMID:30912803 Lgals3 Rat tunicamycin increases expression ISO Lgals3 (Mus musculus) 6480464 Tunicamycin results in increased expression of LGALS3 mRNA CTD PMID:17127020 Lgals3 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of LGALS3 mRNA CTD PMID:24136188 Lgals3 Rat valproic acid affects expression ISO Lgals3 (Mus musculus) 6480464 Valproic Acid affects the expression of LGALS3 mRNA CTD PMID:17963808 Lgals3 Rat valproic acid multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LGALS3 mRNA CTD PMID:27188386 Lgals3 Rat valproic acid increases expression ISO LGALS3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of LGALS3 mRNA CTD PMID:19101580 more ... Lgals3 Rat valproic acid affects expression ISO LGALS3 (Homo sapiens) 6480464 Valproic Acid affects the expression of LGALS3 mRNA CTD PMID:25979313 Lgals3 Rat vanadyl sulfate multiple interactions EXP 6480464 vanadyl sulfate inhibits the reaction [Streptozocin results in increased expression of LGALS3 mRNA] CTD PMID:16684804 Lgals3 Rat vancomycin decreases expression ISO Lgals3 (Mus musculus) 6480464 Vancomycin results in decreased expression of LGALS3 mRNA CTD PMID:18930951 Lgals3 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of LGALS3 mRNA CTD PMID:19015723 Lgals3 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of LGALS3 mRNA CTD PMID:23034163 Lgals3 Rat vorinostat increases expression ISO LGALS3 (Homo sapiens) 6480464 vorinostat results in increased expression of LGALS3 mRNA CTD PMID:26272509 Lgals3 Rat vorinostat multiple interactions ISO LGALS3 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LGALS3 mRNA CTD PMID:27188386 Lgals3 Rat zinc oxide decreases expression EXP 6480464 Zinc Oxide results in decreased expression of LGALS3 protein CTD PMID:33205376
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,4-dichlorobenzene (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 2-nitrofluorene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-chloropropane-1,2-diol (EXP) 3-methylcholanthrene (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (EXP,ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acetamide (EXP) actinomycin D (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bexarotene (EXP) bezafibrate (ISO) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) bleomycin A2 (ISO) bucladesine (ISO) buspirone (EXP) cadmium dichloride (EXP) calcitriol (ISO) calyculin a (ISO) carbon nanotube (ISO) cefaloridine (EXP) CGP 52608 (ISO) chloroform (EXP) choline (ISO) ciglitazone (ISO) cisplatin (EXP,ISO) clofibrate (ISO) cobalt dichloride (EXP) copper(II) sulfate (ISO) Cuprizon (EXP) cycloheximide (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dexamethasone (EXP,ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) dicrotophos (ISO) diethylstilbestrol (EXP,ISO) dimethylarsinic acid (EXP) dioxygen (EXP,ISO) diquat (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) erythromycin estolate (EXP) etoposide (ISO) fenamidone (ISO) ferric oxide (EXP) flurbiprofen (ISO) folic acid (EXP,ISO) furfural (ISO) genistein (ISO) gentamycin (EXP) glafenine (EXP) isoprenaline (ISO) ivermectin (ISO) L-ascorbic acid (EXP) L-methionine (ISO) lactose (ISO) leflunomide (ISO) LY294002 (ISO) manganese(II) chloride (EXP) medroxyprogesterone acetate (ISO) mercury dibromide (ISO) methapyrilene (EXP) methimazole (ISO) methoxychlor (EXP) methylmercury chloride (ISO) microcystin-LR (ISO) mifepristone (EXP) mitomycin C (ISO) monocrotaline (EXP) N,N-diethyl-m-toluamide (EXP) N-acetylsphingosine (ISO) N-ethyl-N-nitrosourea (EXP) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-methyl-N-nitrosourea (EXP,ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP,ISO) N-nitrosomorpholine (EXP) naloxone (EXP) nickel atom (ISO) nickel subsulfide (EXP) nickel sulfate (ISO) niclosamide (ISO) Nonylphenol (ISO) Nutlin-3 (ISO) ochratoxin A (EXP) oxycodone (EXP) ozone (EXP,ISO) panobinostat (ISO) paracetamol (ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) permethrin (EXP) phenacetin (EXP) phenobarbital (EXP,ISO) phenylhydrazine (EXP) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) phosgene (ISO) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) potassium dichromate (ISO) progesterone (ISO) quercetin (EXP,ISO) quinolin-8-ol (ISO) quinoline (ISO) rac-lactic acid (ISO) reactive oxygen species (ISO) resveratrol (EXP) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon atom (ISO) silicon dioxide (EXP,ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP) sodium fluoride (ISO) streptozocin (EXP) sulindac (ISO) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) tetracycline (EXP) theophylline (EXP) thioacetamide (EXP,ISO) titanium dioxide (ISO) tremolite asbestos (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) tris(2-butoxyethyl) phosphate (ISO) tungsten (ISO) tunicamycin (ISO) valdecoxib (EXP) valproic acid (ISO) vanadyl sulfate (EXP) vancomycin (ISO) vinclozolin (EXP) vorinostat (ISO) zinc oxide (EXP)
Biological Process
antimicrobial humoral immune response mediated by antimicrobial peptide (ISO) cell differentiation (IEA) eosinophil chemotaxis (IBA,IEA,ISO) epithelial cell differentiation (IEA,ISO) extracellular matrix organization (ISO) immune system process (IEA) innate immune response (IEA) macrophage chemotaxis (IBA,IEA,ISO) maintenance of protein location (ISO) monocyte chemotaxis (IBA,IEA,ISO) mononuclear cell migration (IEA,ISO) mRNA processing (IEA) negative regulation of apoptotic process (IDA) negative regulation of cell proliferation in bone marrow (IDA) negative regulation of endocytosis (IBA,IEA,ISO) negative regulation of extrinsic apoptotic signaling pathway (IBA,IEA,ISO) negative regulation of immunological synapse formation (ISO) negative regulation of NK T cell activation (IEA,ISO) negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell (ISO) negative regulation of T cell receptor signaling pathway (ISO) neutrophil chemotaxis (IBA,IEA,ISO) positive chemotaxis (IBA,IEA,ISO) positive regulation of angiogenesis (IMP) positive regulation of calcium ion import (IBA,IEA,ISO) positive regulation of cell population proliferation (IMP) positive regulation of dendritic cell differentiation (ISO) positive regulation of mononuclear cell migration (IEA,ISO) positive regulation of protein localization to plasma membrane (IEA,ISO) positive regulation of protein-containing complex assembly (IEA,ISO) positive regulation of serotonin secretion (IDA) regulation of extrinsic apoptotic signaling pathway via death domain receptors (IEA,ISO) regulation of T cell apoptotic process (IEA,ISO) regulation of T cell proliferation (IEA,ISO) response to quercetin (IEP) RNA splicing (IEA) skeletal system development (ISO)
Cellular Component
cell surface (IDA,ISO) cornified envelope (ISO) cytoplasm (IBA,IEA,ISO) cytosol (IEA,ISO) external side of plasma membrane (ISO) extracellular matrix (ISO) extracellular region (IEA) extracellular space (IBA,IDA,IEA,ISO) glial cell projection (ISO) immunological synapse (IBA,IEA,ISO) mitochondrial inner membrane (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IBA,IEA,ISO) plasma membrane (TAS) spliceosomal complex (IEA)
Molecular Function
advanced glycation end-product receptor activity (IDA) carbohydrate binding (IEA,ISO) chemoattractant activity (IEA,ISO) disaccharide binding (IBA,IDA) Fc-gamma receptor I complex binding (IDA) IgE binding (IBA,IDA,IEA,ISO) laminin binding (IBA,IEA,ISO) molecular condensate scaffold activity (IEA,ISO) monosaccharide binding (IDA) oligosaccharide binding (ISO) protein binding (ISO) protein phosphatase binding (IEA,ISO) protein phosphatase inhibitor activity (IEA,ISO) receptor ligand inhibitor activity (IEA,ISO) signaling receptor inhibitor activity (IEA,ISO)
1.
Quercetin Confers Tumoricidal Activity Through Multipathway Mechanisms in A N-Methylnitrosourea Rat Model of Colon Cancer
Ahmed HH, etal., Asian Pac J Cancer Prev. 2016 Nov 1;17(11):4991-4998. doi: 10.22034/APJCP.2016.17.11.4991.
2.
An IgE-binding protein with a distinctive repetitive sequence and homology with an IgG receptor.
Albrandt K, etal., Proc Natl Acad Sci U S A 1987 Oct;84(19):6859-63.
3.
Galectin-3 gene (LGALS3) expression in experimental atherosclerosis and cultured smooth muscle cells.
Arar C, etal., FEBS Lett. 1998 Jul 3;430(3):307-11.
4.
Gene and protein expression of galectin-3 and galectin-9 in experimental pneumococcal meningitis.
Bellac CL, etal., Neurobiol Dis. 2007 Nov;28(2):175-83. Epub 2007 Jul 10.
5.
Galectin-3 in preneoplastic lesions of glioma.
Binh NH, etal., J Neurooncol. 2013 Jan;111(2):123-32. doi: 10.1007/s11060-012-1005-2. Epub 2012 Nov 23.
6.
Galectin-3 mediates aldosterone-induced vascular fibrosis.
Calvier L, etal., Arterioscler Thromb Vasc Biol. 2013 Jan;33(1):67-75. doi: 10.1161/ATVBAHA.112.300569. Epub 2012 Nov 1.
7.
Galectin-3 as a potential prognostic biomarker of severe COVID-19 in SARS-CoV-2 infected patients.
Cervantes-Alvarez E, etal., Sci Rep. 2022 Feb 3;12(1):1856. doi: 10.1038/s41598-022-05968-4.
8.
Epsilon BP, a beta-galactoside-binding animal lectin, recognizes IgE receptor (Fc epsilon RI) and activates mast cells.
Frigeri LG, etal., Biochemistry. 1993 Aug 3;32(30):7644-9.
9.
Expression of biologically active recombinant rat IgE-binding protein in Escherichia coli.
Frigeri LG, etal., J Biol Chem. 1990 Dec 5;265(34):20763-9.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Inflammation-induced modulation of cellular galectin-1 and -3 expression in a model of rat peritonitis.
Gil CD, etal., Inflamm Res. 2006 Mar;55(3):99-107.
12.
Myelin down-regulates myelin phagocytosis by microglia and macrophages through interactions between CD47 on myelin and SIRPa (signal regulatory protein-a) on phagocytes.
Gitik M, etal., J Neuroinflammation. 2011 Mar 15;8:24. doi: 10.1186/1742-2094-8-24.
13.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
14.
Galectin-3 regulates myofibroblast activation and hepatic fibrosis.
Henderson NC, etal., Proc Natl Acad Sci U S A. 2006 Mar 28;103(13):5060-5. Epub 2006 Mar 20.
15.
Enhanced expression of lymphomagenesis-related genes in peripheral blood B cells of chronic hepatitis C patients.
Ito M, etal., Clin Immunol. 2010 Jun;135(3):459-65. doi: 10.1016/j.clim.2010.02.002. Epub 2010 Mar 1.
16.
Immune-mediated beta-cell destruction in vitro and in vivo-A pivotal role for galectin-3.
Karlsen AE, etal., Biochem Biophys Res Commun. 2006 May 26;344(1):406-15. Epub 2006 Mar 29.
17.
Galectin-3 inhibits granulocyte-macrophage colony-stimulating factor (GM-CSF)-driven rat bone marrow cell proliferation and GM-CSF-induced gene transcription.
Krugluger W, etal., Immunobiology. 1997 Jun;197(1):97-109.
18.
Identification of an IgE-binding protein by molecular cloning.
Liu FT, etal., Proc Natl Acad Sci U S A 1985 Jun;82(12):4100-4.
19.
Inhibition of chronic airway inflammation and remodeling by galectin-3 gene therapy in a murine model.
Lopez E, etal., J Immunol. 2006 Feb 1;176(3):1943-50.
20.
Stimulation of proliferation of rat hepatic stellate cells by galectin-1 and galectin-3 through different intracellular signaling pathways.
Maeda N, etal., J Biol Chem. 2003 May 23;278(21):18938-44. Epub 2003 Mar 19.
21.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
22.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
23.
Up-regulation of galectin-3 in acute renal failure of the rat.
Nishiyama J, etal., Am J Pathol. 2000 Sep;157(3):815-23.
24.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
25.
GOA pipeline
RGD automated data pipeline
26.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
27.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
28.
Galectin-3 marks activated macrophages in failure-prone hypertrophied hearts and contributes to cardiac dysfunction.
Sharma UC, etal., Circulation. 2004 Nov 9;110(19):3121-8. Epub 2004 Nov 1.
29.
Identification of blood biomarkers of rheumatoid arthritis by transcript profiling of peripheral blood mononuclear cells from the rat collagen-induced arthritis model.
Shou J, etal., Arthritis Res Ther. 2006;8(1):R28. Epub 2006 Jan 10.
30.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
31.
Multi-modal proteomic analysis of retinal protein expression alterations in a rat model of diabetic retinopathy.
VanGuilder HD, etal., PLoS One. 2011 Jan 13;6(1):e16271. doi: 10.1371/journal.pone.0016271.
32.
Identification of galectin-3 as a high-affinity binding protein for advanced glycation end products (AGE): a new member of the AGE-receptor complex.
Vlassara H, etal., Mol Med. 1995 Sep;1(6):634-46.
33.
Galectin-3 is upregulated in microglial cells in response to ischemic brain lesions, but not to facial nerve axotomy.
Walther M, etal., J Neurosci Res. 2000 Aug 15;61(4):430-5.
34.
A novel function of microRNA let-7d in regulation of galectin-3 expression in attention deficit hyperactivity disorder rat brain.
Wu L, etal., Brain Pathol. 2010 Nov;20(6):1042-54. doi: 10.1111/j.1750-3639.2010.00410.x. Epub 2010 Jun 14.
35.
Galectin-3 mediates post-ischemic tissue remodeling.
Yan YP, etal., Brain Res. 2009 Sep 8;1288:116-24. doi: 10.1016/j.brainres.2009.06.073. Epub 2009 Jun 30.
Lgals3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 23,099,795 - 23,111,731 (+) NCBI GRCr8 mRatBN7.2 15 20,620,083 - 20,632,019 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 20,607,692 - 20,632,025 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 23,400,729 - 23,412,663 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 24,358,692 - 24,370,626 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 22,609,201 - 22,621,133 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 24,153,602 - 24,165,537 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 24,141,651 - 24,165,537 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 28,094,344 - 28,106,281 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 23,327,071 - 23,339,006 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 15 21,014,742 - 21,026,522 (+) NCBI Celera Cytogenetic Map 15 p14 NCBI
LGALS3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 55,129,252 - 55,145,430 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 55,124,110 - 55,145,423 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 55,595,970 - 55,612,148 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 54,665,625 - 54,681,901 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 54,665,757 - 54,681,881 NCBI Celera 14 35,645,428 - 35,661,641 (+) NCBI Celera Cytogenetic Map 14 q22.3 NCBI HuRef 14 35,758,537 - 35,774,750 (+) NCBI HuRef CHM1_1 14 55,534,573 - 55,550,756 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 49,334,442 - 49,350,620 (+) NCBI T2T-CHM13v2.0
Lgals3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 47,611,317 - 47,623,624 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 47,605,208 - 47,623,617 (+) Ensembl GRCm39 Ensembl GRCm38 14 47,373,860 - 47,386,167 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 47,367,751 - 47,386,160 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 47,993,535 - 48,005,842 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 46,295,795 - 46,308,037 (+) NCBI MGSCv36 mm8 Celera 14 43,562,063 - 43,575,064 (+) NCBI Celera Cytogenetic Map 14 C1 NCBI cM Map 14 24.6 NCBI
Lgals3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955409 8,447,774 - 8,452,438 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955409 8,448,120 - 8,452,437 (-) NCBI ChiLan1.0 ChiLan1.0
LGALS3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 56,250,524 - 56,266,924 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 55,467,032 - 55,483,432 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 35,715,850 - 35,732,263 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 53,990,023 - 54,006,412 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 53,990,023 - 54,006,412 (+) Ensembl panpan1.1 panPan2
LGALS3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 30,977,438 - 30,994,711 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 30,983,633 - 30,994,705 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 30,752,177 - 30,763,224 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 31,236,480 - 31,254,738 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 31,236,550 - 31,254,723 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 30,846,505 - 30,857,542 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 30,923,589 - 30,934,646 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 31,288,737 - 31,299,778 (+) NCBI UU_Cfam_GSD_1.0
Lgals3
LGALS3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 184,478,710 - 184,497,951 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 184,478,639 - 184,496,155 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 204,956,478 - 204,974,108 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LGALS3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 32,311,343 - 32,328,335 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 32,311,271 - 32,328,339 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 20,546,585 - 20,562,993 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lgals3
.
Predicted Target Of
Count of predictions: 153 Count of miRNA genes: 116 Interacting mature miRNAs: 135 Transcripts: ENSRNOT00000014216 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641913 Colcr2 Colorectal carcinoma resistance QTL 2 6.57 0.0197 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 15 2266368 22711984 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 10755503 Bp391 Blood pressure QTL 391 2.37 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 20248600 37896129 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat 2324620 Coatc3 Coat color QTL 3 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 15 19856566 46187442 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 631550 Bw7 Body weight QTL 7 3.6 body mass (VT:0001259) body weight (CMO:0000012) 15 19856566 34924750 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 5685002 Bss103 Bone structure and strength QTL 103 2.8 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 15 14481165 28469888 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat
RH127694
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 20,630,850 - 20,631,876 (+) MAPPER mRatBN7.2 Rnor_6.0 15 24,164,371 - 24,165,396 NCBI Rnor6.0 Rnor_5.0 15 28,105,113 - 28,106,138 UniSTS Rnor5.0 RGSC_v3.4 15 23,337,840 - 23,338,865 UniSTS RGSC3.4 Celera 15 21,025,356 - 21,026,381 UniSTS RH 3.4 Map 15 143.2 UniSTS Cytogenetic Map 15 p14 UniSTS
PMC263848P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 20,630,798 - 20,630,919 (+) MAPPER mRatBN7.2 Rnor_6.0 15 24,164,319 - 24,164,439 NCBI Rnor6.0 Rnor_5.0 15 28,105,061 - 28,105,181 UniSTS Rnor5.0 RGSC_v3.4 15 23,337,788 - 23,337,908 UniSTS RGSC3.4 Celera 15 21,025,304 - 21,025,424 UniSTS Cytogenetic Map 15 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014216 ⟹ ENSRNOP00000014216
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 20,620,083 - 20,632,012 (+) Ensembl Rnor_6.0 Ensembl 15 24,153,602 - 24,165,537 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000082304 ⟹ ENSRNOP00000070344
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 20,607,692 - 20,632,025 (+) Ensembl Rnor_6.0 Ensembl 15 24,141,651 - 24,165,535 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000082675 ⟹ ENSRNOP00000070203
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 20,620,083 - 20,632,014 (+) Ensembl Rnor_6.0 Ensembl 15 24,159,647 - 24,165,418 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106924 ⟹ ENSRNOP00000097784
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 20,620,097 - 20,632,025 (+) Ensembl
RefSeq Acc Id:
NM_031832 ⟹ NP_114020
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 23,099,795 - 23,111,729 (+) NCBI mRatBN7.2 15 20,620,083 - 20,632,017 (+) NCBI Rnor_6.0 15 24,153,602 - 24,165,537 (+) NCBI Rnor_5.0 15 28,094,344 - 28,106,281 (+) NCBI RGSC_v3.4 15 23,327,071 - 23,339,006 (+) RGD Celera 15 21,014,742 - 21,026,522 (+) RGD
Sequence:
AACAGCTAGCGGAGCGGCAGGAGGAGCACTAACCAGGAAAATGGCAGACGGCTTCTCACTTAATGATGCCTTAGCTGGCTCTGGAAACCCAAACCCTCGAGGATGGCCTGGTGCATGGGGGAACCAGC
hide sequence
RefSeq Acc Id:
XM_039093700 ⟹ XP_038949628
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 23,100,043 - 23,111,731 (+) NCBI mRatBN7.2 15 20,620,331 - 20,632,019 (+) NCBI
RefSeq Acc Id:
NP_114020 ⟸ NM_031832
- UniProtKB:
V5QR27 (UniProtKB/TrEMBL)
- Sequence:
MADGFSLNDALAGSGNPNPRGWPGAWGNQPGAGGYPGASYPGAYPGQAPPGGYPGQAPPSAYPGPTGPSAYPGPTAPGAYPGPTAPGAFPGQPGGPGAYPSAPGAYPSAPGAYPATGPFGAPTGPLTV
hide sequence
Ensembl Acc Id:
ENSRNOP00000070203 ⟸ ENSRNOT00000082675
Ensembl Acc Id:
ENSRNOP00000070344 ⟸ ENSRNOT00000082304
Ensembl Acc Id:
ENSRNOP00000014216 ⟸ ENSRNOT00000014216
RefSeq Acc Id:
XP_038949628 ⟸ XM_039093700
- Peptide Label:
isoform X1
- UniProtKB:
P08699 (UniProtKB/Swiss-Prot), V5QQP9 (UniProtKB/TrEMBL), A6KE45 (UniProtKB/TrEMBL), V5QR27 (UniProtKB/TrEMBL), V5QRT4 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000097784 ⟸ ENSRNOT00000106924
RGD ID: 13699612 Promoter ID: EPDNEW_R10136 Type: multiple initiation site Name: Lgals3_1 Description: galectin 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 24,153,602 - 24,153,662 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-25
Lgals3
galectin 3
Lgals3
lectin, galactoside-binding, soluble, 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-30
Lgals3
lectin, galactoside-binding, soluble, 3
Lgals3
lectin, galactose binding, soluble 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Lgals3
lectin, galactose binding, soluble 3
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_domains
contains a Tyr-Pro-Gly-Pro/Gln-Ala/Thr-Pro/Ala-Pro-Gly-Ala repetive sequence in N-terminal and a domain with homology of that found in the lymphocyte/macrophage receptor for the Fc portion of IgG
68810
