Symbol:
Pawr
Name:
pro-apoptotic WT1 regulator
RGD ID:
69065
Description:
Enables actin binding activity; protein kinase C binding activity; and protein phosphatase 1 binding activity. Involved in several processes, including detection of stimulus involved in sensory perception of pain; positive regulation of apoptotic process; and regulation of cellular extravasation. Located in actin filament; axon; and neuronal cell body. Biomarker of depressive disorder; epilepsy; middle cerebral artery infarction; and transient cerebral ischemia. Orthologous to human PAWR (pro-apoptotic WT1 regulator); PARTICIPATES IN ceramide signaling pathway; INTERACTS WITH (R,R,R)-alpha-tocopherol; (S)-colchicine; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Par-4; par-4 induced by effectors of apoptosis; Par4; PRKC apoptosis WT1 regulator; PRKC, apoptosis, WT1, regulator; prostate apoptosis response 4 protein; prostate apoptosis response protein 4; transcriptional repressor Par-4-like protein PAWR
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PAWR (pro-apoptotic WT1 regulator) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Pawr (PRKC, apoptosis, WT1, regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pawr (pro-apoptotic WT1 regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PAWR (pro-apoptotic WT1 regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PAWR (pro-apoptotic WT1 regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pawr (pro-apoptotic WT1 regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PAWR (pro-apoptotic WT1 regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PAWR (pro-apoptotic WT1 regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pawr (pro-apoptotic WT1 regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
APBA2 (amyloid beta precursor protein binding family A member 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PAWR (pro-apoptotic WT1 regulator)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Pawr (PRKC, apoptosis, WT1, regulator)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pawr (PRKC, apoptosis, WT1, regulator)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pawr
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
sult1c4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 45,531,480 - 45,611,492 (+) NCBI GRCr8 mRatBN7.2 7 43,645,028 - 43,725,033 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 43,645,084 - 43,725,028 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 45,554,243 - 45,635,692 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 47,757,364 - 47,838,790 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 47,535,105 - 47,616,535 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 51,273,764 - 51,353,700 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 51,273,771 - 51,353,068 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 51,286,663 - 51,366,383 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 47,040,162 - 47,119,613 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 47,060,432 - 47,139,881 (+) NCBI Celera 7 40,512,247 - 40,591,588 (+) NCBI Celera Cytogenetic Map 7 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pawr Rat (-)-demecolcine decreases expression ISO PAWR (Homo sapiens) 6480464 Demecolcine results in decreased expression of PAWR mRNA CTD PMID:23649840 Pawr Rat (R,R,R)-alpha-tocopherol multiple interactions EXP 6480464 alpha-Tocopherol inhibits the reaction [Nerve Growth Factors deficiency results in increased expression of PAWR mRNA] and alpha-Tocopherol inhibits the reaction [Nerve Growth Factors deficiency results in increased expression of PAWR protein] CTD PMID:10428045 Pawr Rat (S)-colchicine increases expression EXP 6480464 Colchicine results in increased expression of PAWR protein CTD PMID:12941380 Pawr Rat (S)-colchicine multiple interactions EXP 6480464 alvocidib inhibits the reaction [Colchicine results in increased expression of PAWR protein] CTD PMID:12941380 Pawr Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PAWR protein CTD PMID:15964511 Pawr Rat 17beta-estradiol multiple interactions EXP 6480464 Estradiol inhibits the reaction [Nerve Growth Factors deficiency results in increased expression of PAWR mRNA] and Estradiol inhibits the reaction [Nerve Growth Factors deficiency results in increased expression of PAWR protein] CTD PMID:10428045 Pawr Rat 17beta-estradiol increases expression ISO PAWR (Homo sapiens) 6480464 Estradiol results in increased expression of PAWR mRNA and Estradiol results in increased expression of PAWR protein CTD PMID:20106945 and PMID:20945400 Pawr Rat 17beta-estradiol multiple interactions ISO PAWR (Homo sapiens) 6480464 EGF protein inhibits the reaction [Estradiol results in decreased expression of PAWR mRNA] CTD PMID:24758408 Pawr Rat 17beta-estradiol decreases expression ISO PAWR (Homo sapiens) 6480464 Estradiol results in decreased expression of PAWR mRNA CTD PMID:24758408 Pawr Rat 1H-pyrazole increases expression ISO Pawr (Mus musculus) 6480464 pyrazole results in increased expression of PAWR mRNA CTD PMID:17945193 Pawr Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PAWR mRNA CTD PMID:34747641 Pawr Rat 2-butoxyethanol increases expression ISO Pawr (Mus musculus) 6480464 n-butoxyethanol results in increased expression of PAWR mRNA CTD PMID:19812364 Pawr Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of PAWR mRNA CTD PMID:19162173 Pawr Rat 4-hydroxyphenyl retinamide increases expression ISO Pawr (Mus musculus) 6480464 Fenretinide results in increased expression of PAWR mRNA CTD PMID:28973697 Pawr Rat 4-phenylbutyric acid decreases expression ISO PAWR (Homo sapiens) 6480464 4-phenylbutyric acid results in decreased expression of PAWR mRNA CTD PMID:14583596 Pawr Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione multiple interactions EXP 6480464 Uric Acid inhibits the reaction [Nerve Growth Factors deficiency results in increased expression of PAWR mRNA] and Uric Acid inhibits the reaction [Nerve Growth Factors deficiency results in increased expression of PAWR protein] CTD PMID:10428045 Pawr Rat acrolein multiple interactions ISO PAWR (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PAWR mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PAWR mRNA CTD PMID:32699268 Pawr Rat aflatoxin B1 increases expression ISO PAWR (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PAWR mRNA CTD PMID:27153756 Pawr Rat Aflatoxin B2 alpha increases methylation ISO PAWR (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PAWR intron CTD PMID:30157460 Pawr Rat all-trans-retinoic acid affects localization ISO PAWR (Homo sapiens) 6480464 Tretinoin affects the localization of PAWR protein CTD PMID:12644474 Pawr Rat alpha-pinene multiple interactions ISO PAWR (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PAWR mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PAWR mRNA CTD PMID:32699268 Pawr Rat alvocidib multiple interactions EXP 6480464 alvocidib inhibits the reaction [Colchicine results in increased expression of PAWR protein] CTD PMID:12941380 Pawr Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PAWR mRNA CTD PMID:16483693 Pawr Rat antirheumatic drug increases expression ISO PAWR (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PAWR mRNA CTD PMID:24449571 Pawr Rat aristolochic acid A decreases expression ISO PAWR (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PAWR mRNA CTD PMID:33212167 Pawr Rat Aroclor 1254 decreases expression ISO Pawr (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PAWR mRNA CTD PMID:23650126 Pawr Rat arsenous acid increases expression ISO PAWR (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PAWR mRNA and Arsenic Trioxide results in increased expression of PAWR protein CTD PMID:16966277 Pawr Rat beauvericin decreases expression ISO PAWR (Homo sapiens) 6480464 beauvericin results in decreased expression of PAWR mRNA CTD PMID:29203277 Pawr Rat benzo[a]pyrene decreases expression ISO Pawr (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PAWR mRNA CTD PMID:19770486 Pawr Rat benzo[a]pyrene affects methylation ISO PAWR (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PAWR intron CTD PMID:30157460 Pawr Rat benzo[a]pyrene increases expression ISO Pawr (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PAWR mRNA CTD PMID:22228805 Pawr Rat benzo[a]pyrene diol epoxide I decreases expression ISO PAWR (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Pawr Rat bis(2-ethylhexyl) phthalate decreases expression ISO Pawr (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PAWR mRNA CTD PMID:33754040 Pawr Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PAWR mRNA CTD PMID:25181051 Pawr Rat bisphenol A decreases expression ISO PAWR (Homo sapiens) 6480464 bisphenol A results in decreased expression of PAWR protein CTD PMID:37567409 Pawr Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PAWR gene CTD PMID:28505145 Pawr Rat bisphenol AF increases expression ISO PAWR (Homo sapiens) 6480464 bisphenol AF results in increased expression of PAWR protein CTD PMID:34186270 Pawr Rat bisphenol F increases expression ISO Pawr (Mus musculus) 6480464 bisphenol F results in increased expression of PAWR mRNA CTD PMID:38685157 Pawr Rat bortezomib multiple interactions ISO PAWR (Homo sapiens) 6480464 [BRCA1 mutant form results in increased susceptibility to Bortezomib] which results in increased expression of PAWR mRNA CTD PMID:25522274 Pawr Rat caffeine decreases phosphorylation ISO PAWR (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PAWR protein CTD PMID:35688186 Pawr Rat carbon nanotube increases expression ISO Pawr (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of PAWR mRNA CTD PMID:25554681 Pawr Rat carboplatin decreases expression EXP 6480464 Carboplatin results in decreased expression of PAWR mRNA CTD PMID:18172885 Pawr Rat chlorpyrifos increases expression ISO Pawr (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PAWR mRNA CTD PMID:37019170 Pawr Rat choline multiple interactions ISO Pawr (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PAWR gene CTD PMID:20938992 Pawr Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of PAWR mRNA CTD PMID:18172885 Pawr Rat cisplatin decreases expression ISO PAWR (Homo sapiens) 6480464 Cisplatin results in decreased expression of PAWR mRNA CTD PMID:27392435 Pawr Rat cisplatin decreases response to substance ISO PAWR (Homo sapiens) 6480464 PAWR mutant form results in decreased susceptibility to Cisplatin CTD PMID:24144893 Pawr Rat cisplatin multiple interactions ISO PAWR (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [PAWR mutant form results in decreased susceptibility to Cisplatin] more ... CTD PMID:20705681 more ... Pawr Rat cladribine multiple interactions ISO PAWR (Homo sapiens) 6480464 Cladribine promotes the reaction [Bendamustine Hydrochloride results in decreased expression of PAWR protein] CTD PMID:12948851 Pawr Rat clofibrate increases expression ISO Pawr (Mus musculus) 6480464 Clofibrate results in increased expression of PAWR mRNA CTD PMID:17585979 Pawr Rat cobalt dichloride increases expression ISO PAWR (Homo sapiens) 6480464 cobaltous chloride results in increased expression of PAWR mRNA CTD PMID:19376846 Pawr Rat copper(II) sulfate increases expression ISO PAWR (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PAWR mRNA CTD PMID:19549813 Pawr Rat coumestrol multiple interactions ISO PAWR (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of PAWR mRNA CTD PMID:19167446 Pawr Rat coumestrol decreases expression ISO PAWR (Homo sapiens) 6480464 Coumestrol results in decreased expression of PAWR mRNA CTD PMID:19167446 Pawr Rat cyclosporin A increases expression ISO PAWR (Homo sapiens) 6480464 Cyclosporine results in increased expression of PAWR mRNA CTD PMID:20106945 and PMID:25562108 Pawr Rat dextran sulfate decreases expression ISO Pawr (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of PAWR protein CTD PMID:32272095 Pawr Rat dextran sulfate multiple interactions ISO Pawr (Mus musculus) 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of PAWR protein] CTD PMID:32272095 Pawr Rat diarsenic trioxide increases expression ISO PAWR (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PAWR mRNA and Arsenic Trioxide results in increased expression of PAWR protein CTD PMID:16966277 Pawr Rat dibutyl phthalate increases expression ISO Pawr (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of PAWR mRNA CTD PMID:17361019 and PMID:21266533 Pawr Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of PAWR mRNA CTD PMID:21266533 and PMID:21745491 Pawr Rat dichloroacetic acid increases expression ISO Pawr (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of PAWR mRNA CTD PMID:28962523 Pawr Rat dioxygen multiple interactions ISO Pawr (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PAWR mRNA CTD PMID:30529165 Pawr Rat diquat decreases expression ISO Pawr (Mus musculus) 6480464 Diquat results in decreased expression of PAWR protein CTD PMID:36851058 Pawr Rat dorsomorphin multiple interactions ISO PAWR (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pawr Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PAWR mRNA CTD PMID:29391264 Pawr Rat Enterolactone multiple interactions ISO PAWR (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of PAWR mRNA CTD PMID:19167446 Pawr Rat epoxiconazole increases expression ISO Pawr (Mus musculus) 6480464 epoxiconazole results in increased expression of PAWR mRNA CTD PMID:35436446 Pawr Rat erianin multiple interactions ISO Pawr (Mus musculus) 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of PAWR protein] CTD PMID:32272095 Pawr Rat fluoranthene multiple interactions ISO Pawr (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of PAWR mRNA CTD PMID:28329830 Pawr Rat folic acid multiple interactions ISO Pawr (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PAWR gene CTD PMID:20938992 Pawr Rat folic acid decreases expression ISO Pawr (Mus musculus) 6480464 Folic Acid results in decreased expression of PAWR mRNA CTD PMID:25629700 Pawr Rat FR900359 increases phosphorylation ISO PAWR (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PAWR protein CTD PMID:37730182 Pawr Rat furan decreases methylation EXP 6480464 furan results in decreased methylation of PAWR gene CTD PMID:27387713 Pawr Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PAWR mRNA CTD PMID:33387578 Pawr Rat hydrogen peroxide affects expression ISO PAWR (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PAWR mRNA CTD PMID:23410634 Pawr Rat irinotecan decreases expression ISO PAWR (Homo sapiens) 6480464 Irinotecan results in decreased expression of PAWR mRNA CTD PMID:20185912 Pawr Rat isotretinoin decreases expression ISO PAWR (Homo sapiens) 6480464 Isotretinoin results in decreased expression of PAWR mRNA CTD PMID:20436886 Pawr Rat ivermectin decreases expression ISO PAWR (Homo sapiens) 6480464 Ivermectin results in decreased expression of PAWR protein CTD PMID:32959892 Pawr Rat L-methionine multiple interactions ISO Pawr (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PAWR gene CTD PMID:20938992 Pawr Rat leflunomide increases expression ISO PAWR (Homo sapiens) 6480464 leflunomide results in increased expression of PAWR mRNA CTD PMID:28988120 Pawr Rat lipopolysaccharide increases expression ISO PAWR (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of PAWR mRNA CTD PMID:35811015 Pawr Rat lipopolysaccharide multiple interactions ISO PAWR (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PAWR mRNA CTD PMID:35811015 Pawr Rat LY294002 multiple interactions ISO PAWR (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [PAWR mutant form results in decreased susceptibility to Cisplatin] CTD PMID:24144893 Pawr Rat melatonin decreases expression EXP 6480464 Melatonin results in decreased expression of PAWR protein CTD PMID:15964511 Pawr Rat menadione affects expression ISO PAWR (Homo sapiens) 6480464 Vitamin K 3 affects the expression of PAWR mRNA CTD PMID:23410634 Pawr Rat mercury dibromide increases expression ISO PAWR (Homo sapiens) 6480464 mercuric bromide results in increased expression of PAWR mRNA CTD PMID:26272509 Pawr Rat mercury dibromide multiple interactions ISO PAWR (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PAWR mRNA CTD PMID:27188386 Pawr Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of PAWR mRNA CTD PMID:19564919 Pawr Rat methylmercury chloride increases expression ISO PAWR (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PAWR mRNA CTD PMID:23179753 more ... Pawr Rat methylmercury chloride multiple interactions ISO PAWR (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PAWR mRNA CTD PMID:27188386 Pawr Rat miglustat multiple interactions ISO Pawr (Mus musculus) 6480464 miglustat inhibits the reaction [[ST8SIA1 protein affects the abundance of Gangliosides] which results in decreased expression of PAWR protein] CTD PMID:11574545 Pawr Rat N-nitrosodiethylamine increases expression ISO Pawr (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of PAWR mRNA CTD PMID:24535843 Pawr Rat nimesulide increases expression ISO PAWR (Homo sapiens) 6480464 nimesulide results in increased expression of PAWR mRNA CTD PMID:10833474 Pawr Rat NS-398 increases expression ISO PAWR (Homo sapiens) 6480464 N-(2-cyclohexyloxy-4-nitrophenyl)methanesulfonamide results in increased expression of PAWR mRNA CTD PMID:10833474 Pawr Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PAWR mRNA CTD PMID:25729387 Pawr Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of PAWR mRNA CTD PMID:25729387 Pawr Rat ozone multiple interactions ISO PAWR (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PAWR mRNA more ... CTD PMID:32699268 Pawr Rat p-menthan-3-ol increases expression ISO PAWR (Homo sapiens) 6480464 Menthol results in increased expression of PAWR mRNA CTD PMID:26760959 Pawr Rat paclitaxel multiple interactions ISO PAWR (Homo sapiens) 6480464 [Cisplatin co-treated with Paclitaxel] results in increased expression of PAWR mRNA CTD PMID:20705681 Pawr Rat paracetamol affects expression ISO Pawr (Mus musculus) 6480464 Acetaminophen affects the expression of PAWR mRNA CTD PMID:17562736 Pawr Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PAWR mRNA CTD PMID:33387578 Pawr Rat paracetamol decreases expression ISO PAWR (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PAWR mRNA CTD PMID:27761495 Pawr Rat perfluorooctanoic acid increases expression ISO PAWR (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of PAWR protein CTD PMID:26879310 Pawr Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of PAWR mRNA CTD PMID:19162173 Pawr Rat phenobarbital affects expression ISO PAWR (Homo sapiens) 6480464 Phenobarbital affects the expression of PAWR mRNA CTD PMID:19159669 Pawr Rat phenylmercury acetate increases expression ISO PAWR (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PAWR mRNA CTD PMID:26272509 Pawr Rat phenylmercury acetate multiple interactions ISO PAWR (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PAWR mRNA CTD PMID:27188386 Pawr Rat pirinixic acid increases expression ISO Pawr (Mus musculus) 6480464 pirinixic acid results in increased expression of PAWR mRNA CTD PMID:18301758 Pawr Rat potassium chromate decreases expression ISO PAWR (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PAWR mRNA CTD PMID:22714537 Pawr Rat propiconazole increases expression ISO Pawr (Mus musculus) 6480464 propiconazole results in increased expression of PAWR mRNA CTD PMID:21278054 Pawr Rat raloxifene increases expression ISO PAWR (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of PAWR mRNA and Raloxifene Hydrochloride results in increased expression of PAWR protein CTD PMID:20945400 Pawr Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PAWR (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PAWR mRNA CTD PMID:35811015 Pawr Rat SB 431542 multiple interactions ISO PAWR (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Pawr Rat SC-58125 increases expression ISO PAWR (Homo sapiens) 6480464 1-((4-methylsulfonyl)phenyl)-3-trifluoromethyl-5-(4-fluorophenyl)pyrazole results in increased expression of PAWR mRNA CTD PMID:10833474 Pawr Rat silver atom increases expression ISO PAWR (Homo sapiens) 6480464 Silver results in increased expression of PAWR mRNA CTD PMID:26014281 Pawr Rat silver(0) increases expression ISO PAWR (Homo sapiens) 6480464 Silver results in increased expression of PAWR mRNA CTD PMID:26014281 Pawr Rat sodium arsenite increases expression ISO PAWR (Homo sapiens) 6480464 sodium arsenite results in increased expression of PAWR mRNA and sodium arsenite results in increased expression of PAWR protein CTD PMID:16966277 and PMID:38568856 Pawr Rat sodium arsenite decreases expression ISO PAWR (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PAWR mRNA CTD PMID:34032870 Pawr Rat Soman increases expression EXP 6480464 Soman results in increased expression of PAWR mRNA CTD PMID:19281266 Pawr Rat sulindac sulfide increases expression ISO PAWR (Homo sapiens) 6480464 sulindac sulfide results in increased expression of PAWR mRNA CTD PMID:10833474 Pawr Rat sunitinib increases expression ISO PAWR (Homo sapiens) 6480464 Sunitinib results in increased expression of PAWR mRNA CTD PMID:31533062 Pawr Rat temozolomide increases expression ISO PAWR (Homo sapiens) 6480464 Temozolomide results in increased expression of PAWR mRNA CTD PMID:31758290 Pawr Rat tert-butyl hydroperoxide affects expression ISO PAWR (Homo sapiens) 6480464 tert-Butylhydroperoxide affects the expression of PAWR mRNA CTD PMID:23410634 Pawr Rat testosterone increases response to substance ISO Pawr (Mus musculus) 6480464 PAWR gene mutant form results in increased susceptibility to Testosterone CTD PMID:15877079 Pawr Rat tetrachloromethane increases expression ISO Pawr (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PAWR mRNA CTD PMID:31919559 Pawr Rat tetrahydropalmatine decreases expression ISO PAWR (Homo sapiens) 6480464 tetrahydropalmatine results in decreased expression of PAWR protein CTD PMID:20109541 Pawr Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PAWR mRNA CTD PMID:23411599 and PMID:34492290 Pawr Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PAWR mRNA CTD PMID:25729387 Pawr Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of PAWR mRNA CTD PMID:25729387 Pawr Rat triadimefon decreases expression ISO PAWR (Homo sapiens) 6480464 triadimefon results in decreased expression of PAWR mRNA CTD PMID:26705709 Pawr Rat trichloroethene increases expression ISO Pawr (Mus musculus) 6480464 Trichloroethylene results in increased expression of PAWR mRNA CTD PMID:25549359 Pawr Rat trichostatin A increases expression ISO PAWR (Homo sapiens) 6480464 trichostatin A results in increased expression of PAWR mRNA CTD PMID:24935251 Pawr Rat triphenyl phosphate affects expression ISO PAWR (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PAWR mRNA CTD PMID:37042841 Pawr Rat valproic acid increases methylation ISO PAWR (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PAWR gene CTD PMID:29154799 Pawr Rat valproic acid affects expression ISO PAWR (Homo sapiens) 6480464 Valproic Acid affects the expression of PAWR mRNA CTD PMID:25979313 Pawr Rat valproic acid increases expression ISO PAWR (Homo sapiens) 6480464 Valproic Acid results in increased expression of PAWR mRNA CTD PMID:23179753 more ... Pawr Rat vitamin E decreases expression ISO PAWR (Homo sapiens) 6480464 Vitamin E results in decreased expression of PAWR mRNA CTD PMID:19244175
Imported Annotations - PID (archival)
(-)-demecolcine (ISO) (R,R,R)-alpha-tocopherol (EXP) (S)-colchicine (EXP) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2-butoxyethanol (ISO) 3H-1,2-dithiole-3-thione (EXP) 4-hydroxyphenyl retinamide (ISO) 4-phenylbutyric acid (ISO) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (EXP) acrolein (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) alvocidib (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenous acid (ISO) beauvericin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) bortezomib (ISO) caffeine (ISO) carbon nanotube (ISO) carboplatin (EXP) chlorpyrifos (ISO) choline (ISO) cisplatin (EXP,ISO) cladribine (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) dichloroacetic acid (ISO) dioxygen (ISO) diquat (ISO) dorsomorphin (ISO) endosulfan (EXP) Enterolactone (ISO) epoxiconazole (ISO) erianin (ISO) fluoranthene (ISO) folic acid (ISO) FR900359 (ISO) furan (EXP) gentamycin (EXP) hydrogen peroxide (ISO) irinotecan (ISO) isotretinoin (ISO) ivermectin (ISO) L-methionine (ISO) leflunomide (ISO) lipopolysaccharide (ISO) LY294002 (ISO) melatonin (EXP) menadione (ISO) mercury dibromide (ISO) methamphetamine (EXP) methylmercury chloride (ISO) miglustat (ISO) N-nitrosodiethylamine (ISO) nimesulide (ISO) NS-398 (ISO) oxaliplatin (EXP) ozone (ISO) p-menthan-3-ol (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP,ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) potassium chromate (ISO) propiconazole (ISO) raloxifene (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) SC-58125 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) Soman (EXP) sulindac sulfide (ISO) sunitinib (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) tetrahydropalmatine (ISO) thioacetamide (EXP) topotecan (EXP) triadimefon (ISO) trichloroethene (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vitamin E (ISO)
1.
Protease-activated receptor-4: a novel mechanism of inflammatory pain modulation.
Asfaha S, etal., Br J Pharmacol. 2007 Jan;150(2):176-85. Epub 2006 Dec 18.
2.
Immunohistochemical analysis of the proapoptotic protein Par-4 in normal rat tissues.
Boghaert ER, etal., Cell Growth Differ. 1997 Aug;8(8):881-90.
3.
Par-4-mediated recruitment of Amida to the actin cytoskeleton leads to the induction of apoptosis.
Boosen M, etal., Exp Cell Res. 2005 Dec 10;311(2):177-91. Epub 2005 Oct 14.
4.
The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis.
Burikhanov R, etal., Cell. 2009 Jul 23;138(2):377-88. doi: 10.1016/j.cell.2009.05.022.
5.
Prostate apoptosis response-4 mediates trophic factor withdrawal-induced apoptosis of hippocampal neurons: actions prior to mitochondrial dysfunction and caspase activation.
Chan SL, etal., J Neurochem. 1999 Aug;73(2):502-12.
6.
Evidence for the involvement of Par-4 in ischemic neuron cell death.
Culmsee C, etal., J Cereb Blood Flow Metab. 2001 Apr;21(4):334-43.
7.
Regulation of the proapoptotic functions of prostate apoptosis response-4 (Par-4) by casein kinase 2 in prostate cancer cells.
de Thonel A, etal., Cell Death Dis. 2014 Jan 23;5:e1016. doi: 10.1038/cddis.2013.532.
8.
Regional expression of Par-4 mRNA and protein after fluid percussion brain injury in the rat.
Dhillon HS, etal., Exp Neurol. 2001 Jul;170(1):140-8.
9.
Prostate apoptosis response-4 production in synaptic compartments following apoptotic and excitotoxic insults: evidence for a pivotal role in mitochondrial dysfunction and neuronal degeneration.
Duan W, etal., J Neurochem. 1999 Jun;72(6):2312-22.
10.
Long-term melatonin or 17beta-estradiol supplementation alleviates oxidative stress in ovariectomized adult rats.
Feng Z and Zhang JT, Free Radic Biol Med. 2005 Jul 15;39(2):195-204. Epub 2005 Mar 25.
11.
Prostate apoptosis response-4 is expressed in normal cholangiocytes, is down-regulated in human cholangiocarcinoma, and promotes apoptosis of neoplastic cholangiocytes when induced pharmacologically.
Franchitto A, etal., Am J Pathol. 2010 Oct;177(4):1779-90. doi: 10.2353/ajpath.2010.091171. Epub 2010 Aug 19.
12.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
13.
Pro-apoptotic Par-4 and dopamine D2 receptor in temporal cortex in schizophrenia, bipolar disorder and major depression.
Glantz LA, etal., Schizophr Res. 2010 May;118(1-3):292-9. doi: 10.1016/j.schres.2009.12.027. Epub 2010 Jan 13.
14.
Regulation of the expression of prostate apoptosis response protein 4 (Par-4) in rat granulosa cells.
Gonzalez IH, etal., Apoptosis. 2007 Apr;12(4):769-79.
15.
Par-4 is a mediator of neuronal degeneration associated with the pathogenesis of Alzheimer disease.
Guo Q, etal., Nat Med. 1998 Aug;4(8):957-62.
16.
Focal ischemia induces expression of protease-activated receptor1 (PAR1) and PAR3 on microglia and enhances PAR4 labeling in the penumbra.
Henrich-Noack P, etal., Brain Res. 2006 Jan 27;1070(1):232-41. Epub 2006 Jan 3.
17.
Cellular expression pattern of the protease-activated receptor 4 in the hippocampus in naive rats and after global ischaemia.
Henrich-Noack P, etal., J Neurosci Res. 2010 Mar;88(4):850-7. doi: 10.1002/jnr.22261.
18.
Neuroprotective effect of ghrelin is associated with decreased expression of prostate apoptosis response-4.
Hwang S, etal., Endocr J. 2009;56(4):609-17. Epub 2009 Apr 7.
19.
Differential expression, time course and distribution of four PARs in rats with endotoxin-induced acute lung injury.
Jesmin S, etal., Inflammation. 2007 Apr;30(1-2):14-27. Epub 2006 Nov 30.
20.
Dual modulation by thrombin of the motility of rat oesophageal muscularis mucosae via two distinct protease-activated receptors (PARs): a novel role for PAR-4 as opposed to PAR-1.
Kawabata A, etal., Br J Pharmacol. 2000 Oct;131(3):578-84.
21.
Prostate-apoptosis response-4 phosphorylation in vascular smooth muscle.
MacDonald JA, etal., Arch Biochem Biophys. 2013 Jul 1;535(1):84-90. doi: 10.1016/j.abb.2012.11.009. Epub 2012 Dec 3.
22.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
23.
Evidence for the presence of functional protease activated receptor 4 (PAR4) in the rat colon.
Mule F, etal., Gut. 2004 Feb;53(2):229-34.
24.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
25.
Interaction partners of Dlk/ZIP kinase: co-expression of Dlk/ZIP kinase and Par-4 results in cytoplasmic retention and apoptosis.
Page G, etal., Oncogene. 1999 Dec 2;18(51):7265-73.
26.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
27.
GOA pipeline
RGD automated data pipeline
28.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
29.
Protease-activated receptor subtype expression in developing eye and adult retina of the rat after optic nerve crush.
Rohatgi T, etal., J Neurosci Res 2003 Jul 15;73(2):246-54.
30.
Transient focal ischemia in rat brain differentially regulates mRNA expression of protease-activated receptors 1 to 4.
Rohatgi T, etal., J Neurosci Res 2004 Jan 15;75(2):273-9.
31.
Proteinase-activated receptor-4 (PAR4) activation leads to sensitization of rat joint primary afferents via a bradykinin B2 receptor-dependent mechanism.
Russell FA, etal., J Neurophysiol. 2010 Jan;103(1):155-63. doi: 10.1152/jn.00486.2009. Epub 2009 Nov 4.
32.
The pronociceptive effect of proteinase-activated receptor-4 stimulation in rat knee joints is dependent on mast cell activation.
Russell FA, etal., Pain. 2011 Feb;152(2):354-60. doi: 10.1016/j.pain.2010.10.038.
33.
Commonality of the gene programs induced by effectors of apoptosis in androgen-dependent and -independent prostate cells.
Sells SF, etal., Cell Growth Differ 1994 Apr;5(4):457-66.
34.
Inhibiting protease-activated receptor 4 limits myocardial ischemia/reperfusion injury in rat hearts by unmasking adenosine signaling.
Strande JL, etal., J Pharmacol Exp Ther. 2008 Mar;324(3):1045-54. Epub 2007 Nov 30.
35.
Localization of 54 rat genes, and definition of new synteny groups conserved in the human and the rat.
Szpirer C, etal., Mamm Genome 2000 Sep;11(9):729-35
36.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
37.
Identification of protease-activated receptor-4 (PAR-4) in puromycin-purified brain capillary endothelial cells cultured on Matrigel.
Vajda S, etal., Neurochem Int. 2008 May;52(6):1234-9. doi: 10.1016/j.neuint.2008.01.003. Epub 2008 Jan 12.
38.
Characterization of thrombin-induced leukocyte rolling and adherence: a potential proinflammatory role for proteinase-activated receptor-4.
Vergnolle N, etal., J Immunol. 2002 Aug 1;169(3):1467-73.
39.
Binding of Par-4 to the actin cytoskeleton is essential for Par-4/Dlk-mediated apoptosis.
Vetterkind S, etal., Exp Cell Res. 2005 May 1;305(2):392-408.
40.
Par-4: a new activator of myosin phosphatase.
Vetterkind S, etal., Mol Biol Cell. 2010 Apr 1;21(7):1214-24. doi: 10.1091/mbc.E09-08-0711. Epub 2010 Feb 3.
41.
Interleukin-1beta increased the expression of protease-activated receptor 4 mRNA and protein in dorsal root ganglion neurons.
Wang Z, etal., Neurochem Res. 2013 Sep;38(9):1895-903. doi: 10.1007/s11064-013-1095-z. Epub 2013 Jun 18.
42.
Stress-induced depressive behaviors are correlated with Par-4 and DRD2 expression in rat striatum.
Zhu X, etal., Behav Brain Res. 2011 Oct 1;223(2):329-35. Epub 2011 May 8.
Pawr Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 45,531,480 - 45,611,492 (+) NCBI GRCr8 mRatBN7.2 7 43,645,028 - 43,725,033 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 43,645,084 - 43,725,028 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 45,554,243 - 45,635,692 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 47,757,364 - 47,838,790 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 47,535,105 - 47,616,535 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 51,273,764 - 51,353,700 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 51,273,771 - 51,353,068 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 51,286,663 - 51,366,383 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 47,040,162 - 47,119,613 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 47,060,432 - 47,139,881 (+) NCBI Celera 7 40,512,247 - 40,591,588 (+) NCBI Celera Cytogenetic Map 7 q21 NCBI
PAWR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 79,584,879 - 79,690,964 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 79,574,979 - 79,690,964 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 79,978,659 - 80,084,744 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 78,509,876 - 78,608,921 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 78,488,214 - 78,587,258 NCBI Celera 12 79,652,459 - 79,751,312 (-) NCBI Celera Cytogenetic Map 12 q21.2 NCBI HuRef 12 77,042,009 - 77,141,117 (-) NCBI HuRef CHM1_1 12 79,952,168 - 80,051,122 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 79,563,553 - 79,669,620 (-) NCBI T2T-CHM13v2.0
Pawr Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 108,168,050 - 108,250,708 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 108,167,982 - 108,250,101 (+) Ensembl GRCm39 Ensembl GRCm38 10 108,332,189 - 108,414,391 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 108,332,121 - 108,414,240 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 107,769,245 - 107,851,447 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 107,736,299 - 107,817,863 (+) NCBI MGSCv36 mm8 Celera 10 110,266,638 - 110,348,648 (+) NCBI Celera Cytogenetic Map 10 D1 NCBI cM Map 10 56.43 NCBI
Pawr Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 18,434,711 - 18,540,710 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 18,434,711 - 18,540,710 (-) NCBI ChiLan1.0 ChiLan1.0
PAWR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 87,634,172 - 87,743,476 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 87,630,560 - 87,739,846 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 77,114,282 - 77,224,116 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 79,964,693 - 80,071,088 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 79,969,517 - 80,070,796 (-) Ensembl panpan1.1 panPan2
PAWR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 22,114,014 - 22,159,287 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 22,543,122 - 22,644,822 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 22,466,453 - 22,568,184 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 22,468,188 - 22,568,833 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 22,054,871 - 22,156,503 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 22,115,634 - 22,217,474 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 22,355,750 - 22,457,672 (-) NCBI UU_Cfam_GSD_1.0
Pawr
PAWR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 101,693,246 - 101,797,838 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 101,693,145 - 101,797,842 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 106,705,487 - 106,742,756 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PAWR Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 75,132,547 - 75,219,633 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 75,133,186 - 75,219,072 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 170,232,946 - 170,321,286 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pawr
.
Predicted Target Of
Count of predictions: 501 Count of miRNA genes: 255 Interacting mature miRNAs: 313 Transcripts: ENSRNOT00000008222 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1354644 Spl4 Serum phospholipid level QTL 4 4.9 blood phospholipid amount (VT:0006084) blood phospholipid level (CMO:0001169) 7 19654317 49753746 Rat 7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 1354637 Scl30 Serum cholesterol level QTL 30 3.7 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 7 19654317 49753746 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2303629 Vencon3 Ventilatory control QTL 3 7.25 respiration trait (VT:0001943) respiration rate (CMO:0000289) 7 41109692 56793354 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1300138 Hrtrt9 Heart rate QTL 9 4.72 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 29409683 53612950 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
RH129154
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 43,724,790 - 43,724,976 (-) MAPPER mRatBN7.2 Rnor_6.0 7 51,273,823 - 51,274,008 NCBI Rnor6.0 Rnor_5.0 7 51,286,722 - 51,286,907 UniSTS Rnor5.0 RGSC_v3.4 7 47,119,373 - 47,119,558 UniSTS RGSC3.4 Celera 7 40,591,348 - 40,591,533 UniSTS RH 3.4 Map 7 351.71 UniSTS Cytogenetic Map 7 q21 UniSTS
AU047800
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 43,646,571 - 43,646,802 (-) MAPPER mRatBN7.2 Rnor_6.0 7 51,352,041 - 51,352,271 NCBI Rnor6.0 Rnor_5.0 7 51,364,748 - 51,364,978 UniSTS Rnor5.0 RGSC_v3.4 7 47,040,959 - 47,041,189 UniSTS RGSC3.4 Celera 7 40,513,044 - 40,513,274 UniSTS Cytogenetic Map 7 q21 UniSTS
AU047769
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 43,646,548 - 43,646,803 (-) MAPPER mRatBN7.2 Rnor_6.0 7 51,352,040 - 51,352,294 NCBI Rnor6.0 Rnor_5.0 7 51,364,747 - 51,365,001 UniSTS Rnor5.0 RGSC_v3.4 7 47,040,936 - 47,041,190 UniSTS RGSC3.4 Celera 7 40,513,021 - 40,513,275 UniSTS Cytogenetic Map 7 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000008222 ⟹ ENSRNOP00000008222
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 43,645,775 - 43,725,028 (+) Ensembl Rnor_6.0 Ensembl 7 51,273,771 - 51,353,068 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096379 ⟹ ENSRNOP00000093356
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 43,645,841 - 43,725,028 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113713 ⟹ ENSRNOP00000085170
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 43,645,084 - 43,725,028 (+) Ensembl
RefSeq Acc Id:
NM_033485 ⟹ NP_277020
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 45,532,239 - 45,611,492 (+) NCBI mRatBN7.2 7 43,645,775 - 43,725,031 (+) NCBI Rnor_6.0 7 51,273,768 - 51,353,068 (-) NCBI Rnor_5.0 7 51,286,663 - 51,366,383 (-) NCBI RGSC_v3.4 7 47,040,162 - 47,119,613 (+) RGD Celera 7 40,512,247 - 40,591,588 (+) RGD
Sequence:
CAGGCGGCGGCGGCGGGAGTCAGGAGTCGCGGCGTGAGGGGCGCCCCCGCCGGCCCCTCTGGGAACATGGCGACCGGCGGCTATCGGAGCAGCGGCAGCACCACGGACTTCCTGGAGGAGTGGAAAGC
hide sequence
RefSeq Acc Id:
XM_006241317 ⟹ XP_006241379
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 45,531,480 - 45,611,492 (+) NCBI mRatBN7.2 7 43,645,029 - 43,725,033 (+) NCBI Rnor_6.0 7 51,273,764 - 51,353,700 (-) NCBI Rnor_5.0 7 51,286,663 - 51,366,383 (-) NCBI
Sequence:
CCCCTCGCTCGCTCCCTCCCTCCAGCCAGGGACTGCCCCGGAGCTCCGGCCGGCGAGCTTGCGGCTGCTGGTCGTCCGCGTCGCGGGCTCTCCGGCTCACCTGGACAACCCTCCTCCCCGCCCCGCGC
hide sequence
RefSeq Acc Id:
XM_039079857 ⟹ XP_038935785
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 45,531,480 - 45,611,492 (+) NCBI mRatBN7.2 7 43,645,028 - 43,725,033 (+) NCBI
RefSeq Acc Id:
NP_277020 ⟸ NM_033485
- UniProtKB:
Q62627 (UniProtKB/Swiss-Prot), A6IGE0 (UniProtKB/TrEMBL)
- Sequence:
MATGGYRSSGSTTDFLEEWKAKREKMRAKQNPVGPGSSGGDPAAKSPAGPLAQTTAAGTSELNHGPAGAAAPAAPGPGALNCAHGSSALPRGAPGSRRPEDECPIAAGAAGAPASRGDEEEPDSAPEK
hide sequence
RefSeq Acc Id:
XP_006241379 ⟸ XM_006241317
- Peptide Label:
isoform X1
- UniProtKB:
Q62627 (UniProtKB/Swiss-Prot), A6IGE0 (UniProtKB/TrEMBL)
- Sequence:
MATGGYRSSGSTTDFLEEWKAKREKMRAKQNPVGPGSSGGDPAAKSPAGPLAQTTAAGTSELNHGPAGAAAPAAPGPGALNCAHGSSALPRGAPGSRRPEDECPIAAGAAGAPASRGDEEEPDSAPEK
hide sequence
Ensembl Acc Id:
ENSRNOP00000008222 ⟸ ENSRNOT00000008222
RefSeq Acc Id:
XP_038935785 ⟸ XM_039079857
- Peptide Label:
isoform X1
- UniProtKB:
Q62627 (UniProtKB/Swiss-Prot), A6IGE0 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000085170 ⟸ ENSRNOT00000113713
Ensembl Acc Id:
ENSRNOP00000093356 ⟸ ENSRNOT00000096379
RGD ID: 13695182 Promoter ID: EPDNEW_R5707 Type: single initiation site Name: Pawr_1 Description: pro-apoptotic WT1 regulator SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 51,353,084 - 51,353,144 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-16
Pawr
pro-apoptotic WT1 regulator
Pawr
PRKC, apoptosis, WT1, regulator
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Pawr
PRKC, apoptosis, WT1, regulator
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
expressed in prostate
68876
