Advanced Search (OLGA)

Gene: Uqcrfs1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1) Rattus norvegicus

Analyze

Symbol:

Uqcrfs1

Name:

ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1

RGD ID:

628838

Description:

Predicted to enable oxidoreductase activity. Involved in response to hormone and response to xenobiotic stimulus. Located in mitochondrial membrane. Part of respiratory chain complex III. Human ortholog(s) of this gene implicated in mitochondrial complex III deficiency. Orthologous to several human genes including UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1); PARTICIPATES IN Alzheimer's disease pathway; Huntington's disease pathway; oxidative phosphorylation pathway; INTERACTS WITH 17beta-estradiol; 3-chloropropane-1,2-diol; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

complex III subunit 5; cytochrome b-c1 complex subunit 5; cytochrome b-c1 complex subunit Rieske, mitochondrial; liver regeneration-related protein LRRGT00195; LRRGT00195; MGC105530; rieske iron-sulfur protein; Rieske protein UQCRFS1; RISP; ubiquinol-cytochrome c reductase iron-sulfur subunit

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	34,173,787 - 34,190,952 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	34,173,833 - 34,190,950 (+)	Ensembl				GRCr8
mRatBN7.2	17	33,977,908 - 33,982,478 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	33,977,921 - 33,982,479 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	33,816,701 - 33,820,962 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	35,420,584 - 35,424,845 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	33,812,512 - 33,816,773 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	35,677,984 - 35,682,262 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	35,677,984 - 35,682,259 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	36,991,588 - 36,995,866 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	40,429,806 - 40,434,083 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	33,517,087 - 33,521,364 (+)	NCBI		Celera
RGSC_v3.1	17	40,432,755 - 40,436,859 (+)	NCBI
Cytogenetic Map	17	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cardiomyopathy (ISO)

Experimental Seizures (IEP)

lactic acidosis (ISO)

Mitochondrial Complex III Deficiency Nuclear Type 10 (ISO)

mitochondrial metabolism disease (ISS)

Myocardial Ischemia (ISO)

propionic acidemia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(S)-nicotine (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-naphthylamine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

5-fluorouracil (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

ampicillin (EXP)

antimycin A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calcium dichloride (EXP)

choline (ISO)

clofibric acid (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

corosolic acid (ISO)

cyclosporin A (EXP)

daunorubicin (EXP)

deoxynivalenol (ISO)

dibutyl phthalate (ISO)

dioxygen (EXP)

doxorubicin (EXP,ISO)

ethanol (ISO)

folic acid (ISO)

folpet (ISO)

gentamycin (EXP)

hesperetin (ISO)

hydrogen peroxide (ISO)

isoniazide (ISO)

ivermectin (ISO)

L-methionine (EXP,ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

lithium atom (EXP)

lithium hydride (EXP)

melittin (ISO)

metronidazole (EXP)

N-nitrosodiethylamine (EXP)

neomycin (EXP)

nicotine (ISO)

osimertinib (EXP)

oxybenzone (EXP)

paracetamol (ISO)

paraquat (ISO)

perfluorooctanoic acid (ISO)

phenylarsine oxide (EXP)

pirinixic acid (ISO)

rotenone (EXP,ISO)

sodium arsenite (EXP,ISO)

sodium fluoride (ISO)

sulforaphane (ISO)

sunitinib (ISO)

T-2 toxin (EXP)

tamoxifen (ISO)

tebufenpyrad (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (EXP)

tolcapone (EXP)

toluene (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

tungsten (ISO)

tunicamycin (ISO)

vancomycin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

mitochondrial electron transport, ubiquinol to cytochrome c (IBA)

mitochondrial respiratory chain complex III assembly (ISO)

proton transmembrane transport (IEA)

respiratory electron transport chain (IEA,ISO,ISS)

response to hormone (IEP)

response to xenobiotic stimulus (IEP)

Cellular Component

membrane (IEA)

mitochondrial inner membrane (IEA,ISO)

mitochondrial membrane (IDA,IEA)

mitochondrion (IEA,ISO)

respiratory chain complex III (IBA,IDA,IEA,ISO,TAS)

Molecular Function

2 iron, 2 sulfur cluster binding (IEA)

iron-sulfur cluster binding (IEA)

metal ion binding (IEA)

oxidoreductase activity (IBA)

protein binding (ISO)

protein-containing complex binding (IDA)

quinol-cytochrome-c reductase activity (IEA,TAS)

Molecular Pathway Annotations Click to see Annotation Detail View

Alzheimer's disease pathway (IEA)

Huntington's disease pathway (IEA)

oxidative phosphorylation pathway (IEA)

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Dephosphorylation of the Rieske iron-sulfur protein after induction of the mitochondrial permeability transition.	He L and Lemasters JJ, Biochem Biophys Res Commun. 2005 Sep 2;334(3):829-37.
3.	Molecular mechanisms of doxorubicin-induced cardiomyopathy. Selective suppression of Reiske iron-sulfur protein, ADP/ATP translocase, and phosphofructokinase genes is associated with ATP depletion in rat cardiomyocytes.	Jeyaseelan R, etal., J Biol Chem. 1997 Feb 28;272(9):5828-32.
4.	Thyroid hormone regulation of nuclear-encoded mitochondrial inner membrane polypeptides of the liver.	Joste V, etal., Eur J Biochem. 1989 Sep 1;184(1):255-60.
5.	Proteomic identification of the involvement of the mitochondrial rieske protein in epilepsy.	Junker H, etal., Epilepsia. 2005 Mar;46(3):339-43.
6.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
7.	Alteration of renal respiratory Complex-III during experimental type-1 diabetes.	Munusamy S, etal., BMC Endocr Disord. 2009 Jan 23;9:2.
8.	Cloning and sequence analysis of a cDNA encoding the Rieske iron-sulfur protein of rat mitochondrial cytochrome bc1 complex.	Nishikimi M, etal., Biochem Biophys Res Commun 1989 Feb 28;159(1):19-25.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Mass spectrometric characterization of mitochondrial electron transport complexes: subunits of the rat heart ubiquinol-cytochrome c reductase.	Sun G, etal., J Mass Spectrom 2003 May;38(5):531-9.

Additional References at PubMed

PMID:12477932	PMID:12865426	PMID:14651853	PMID:16120479	PMID:17634366	PMID:18614015	PMID:20833797	PMID:21700703	PMID:23168492	PMID:28844695	PMID:29476059	PMID:30053369
PMID:31505169	PMID:35352799

Genomics

Comparative Map Data

Uqcrfs1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	34,173,787 - 34,190,952 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	34,173,833 - 34,190,950 (+)	Ensembl				GRCr8
mRatBN7.2	17	33,977,908 - 33,982,478 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	33,977,921 - 33,982,479 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	33,816,701 - 33,820,962 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	35,420,584 - 35,424,845 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	33,812,512 - 33,816,773 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	35,677,984 - 35,682,262 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	35,677,984 - 35,682,259 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	36,991,588 - 36,995,866 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	40,429,806 - 40,434,083 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	33,517,087 - 33,521,364 (+)	NCBI		Celera
RGSC_v3.1	17	40,432,755 - 40,436,859 (+)	NCBI
Cytogenetic Map	17	p12	NCBI

UQCRFS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	29,205,320 - 29,213,151 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	29,205,320 - 29,213,151 (-)	Ensembl			hg38	GRCh38
GRCh37	19	29,696,227 - 29,704,058 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	34,390,007 - 34,395,954 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	34,390,006 - 34,395,954	NCBI
Celera	19	26,400,450 - 26,406,405 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI
HuRef	19	26,215,131 - 26,221,101 (-)	NCBI		HuRef
CHM1_1	19	29,699,125 - 29,705,094 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	31,736,436 - 31,744,253 (-)	NCBI		T2T-CHM13v2.0

Uqcrfs1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	30,724,295 - 30,729,299 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	30,724,291 - 30,729,345 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	30,540,312 - 30,545,316 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	30,540,308 - 30,545,362 (-)	Ensembl			mm10	GRCm38
MGSCv37	13	30,632,181 - 30,637,185 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	30,547,777 - 30,552,785 (-)	NCBI		MGSCv36	mm8
Celera	13	30,754,531 - 30,759,562 (-)	NCBI		Celera
Cytogenetic Map	13	A3.2	NCBI
cM Map	13	13.23	NCBI

LOC102014998
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	8,331,153 - 8,338,628 (+)	Ensembl
ChiLan1.0	NW_004955468	8,331,153 - 8,338,628 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100974890
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	35,192,052 - 35,197,971 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	37,188,573 - 37,194,492 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	26,139,335 - 26,145,231 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	34,905,765 - 34,911,712 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	34,905,765 - 34,911,712 (-)	Ensembl			panPan2	panpan1.1

UQCRFS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	122,035,193 - 122,038,032 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	122,035,197 - 122,037,759 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	121,336,791 - 121,339,788 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	122,668,156 - 122,671,153 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	122,668,169 - 122,672,983 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	122,243,598 - 122,246,656 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	121,850,901 - 121,854,019 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	122,914,720 - 122,918,053 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

LOC101959727
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	5,595,723 - 5,600,927 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936570	6,044,697 - 6,054,070 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936570	6,044,969 - 6,051,046 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100522678
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	39,364,890 - 39,373,872 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	39,366,761 - 39,373,876 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	34,525,752 - 34,530,705 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UQCRFS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	24,293,640 - 24,298,983 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	24,293,920 - 24,299,043 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	1,814,696 - 1,820,587 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

LOC101708594
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	4,430,723 - 4,435,457 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624794	4,428,339 - 4,435,363 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

LOC116883471
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	49,552,041 - 49,556,679 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Uqcrfs1
94 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	63
Count of miRNA genes:	45
Interacting mature miRNAs:	57
Transcripts:	ENSRNOT00000024609
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	43999106	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9266755	40968173	Rat
70210	Cm15	Cardiac mass QTL 15	6.5		heart right ventricle mass (VT:0007033)	heart right ventricle wet weight (CMO:0000072)	17	30066472	75066472	Rat
8552966	Pigfal18	Plasma insulin-like growth factor 1 level QTL 18	8.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	12860942	57860942	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2120843	42054133	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	33104645	78104645	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	6221998	58177198	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22660799	55604694	Rat
9589151	Insul30	Insulin level QTL 30	8.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	12860942	57860942	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	32199534	49497050	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21498994	50592236	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27233445	83975845	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4733534	49733534	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23286322	64246472	Rat
9589057	Scfw6	Subcutaneous fat weight QTL 6	8.62	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	17	12860942	57860942	Rat
2317045	Aia11	Adjuvant induced arthritis QTL 11	4.06		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	26522051	71522051	Rat
9590154	Scort9	Serum corticosterone level QTL 9	23.57	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	12860942	57860942	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	22019705	67019705	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24390595	84432719	Rat
9590088	Insglur7	Insulin/glucose ratio QTL 7	20.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	17	12860942	57860942	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	32199534	55604694	Rat
2317053	Aia25	Adjuvant induced arthritis QTL 25	2.69		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	10604694	55604694	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	1	36045694	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15537025	60531414	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	33104645	78104645	Rat
7411666	Foco31	Food consumption QTL 31	11.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	17	12860942	57860942	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4733534	49733534	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23858926	68858926	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23858926	68858926	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27233445	65155015	Rat
4889891	Eae32	Experimental allergic encephalomyelitis QTL 32	4.8	0.0002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	27233445	72233445	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23858926	68858926	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	38037084	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23858926	68858926	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23858926	68858926	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	43999106	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	32199534	86201342	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	43999106	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			24136127	84432719	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat

Markers in Region

RH143354

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	33,977,967 - 33,978,070 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	35,677,992 - 35,678,094	NCBI	Rnor6.0
Rnor_5.0	17	36,991,596 - 36,991,698	UniSTS	Rnor5.0
RGSC_v3.4	17	40,429,814 - 40,429,916	UniSTS	RGSC3.4
Celera	17	33,517,095 - 33,517,197	UniSTS
RH 3.4 Map	17	375.9	UniSTS
Cytogenetic Map	17	p12	UniSTS

RH127960

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	33,982,051 - 33,982,271 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	35,682,077 - 35,682,296	NCBI	Rnor6.0
Rnor_5.0	17	36,995,681 - 36,995,900	UniSTS	Rnor5.0
RGSC_v3.4	17	40,433,898 - 40,434,117	UniSTS	RGSC3.4
Celera	17	33,521,179 - 33,521,398	UniSTS
RH 3.4 Map	17	375.9	UniSTS
Cytogenetic Map	17	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008888	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276184	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY539946	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC085339	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213441	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215591	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215844	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216171	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216362	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217935	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219395	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224874	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226716	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M24542	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024609 ⟹ ENSRNOP00000024609

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	34,186,584 - 34,190,950 (+)	Ensembl
mRatBN7.2 Ensembl	17	33,977,921 - 33,982,479 (+)	Ensembl
Rnor_6.0 Ensembl	17	35,677,984 - 35,682,259 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000126950 ⟹ ENSRNOP00000099852

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	34,173,833 - 34,190,950 (+)	Ensembl

RefSeq Acc Id:

NM_001008888 ⟹ NP_001008888

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	34,186,602 - 34,190,879 (+)	NCBI
mRatBN7.2	17	33,977,960 - 33,982,237 (+)	NCBI
Rnor_6.0	17	35,677,984 - 35,682,262 (+)	NCBI
Rnor_5.0	17	36,991,588 - 36,995,866 (+)	NCBI
RGSC_v3.4	17	40,429,806 - 40,434,083 (+)	RGD
Celera	17	33,517,087 - 33,521,364 (+)	RGD

Sequence:

show sequence

GTTCGAACGGAAGGTCGTCCCTGTGACCGACTAGGTAGTTGGAGCAGCTGTCGCCATGTTGTCG
GTCGCTGCCCGCTCGGGCCCGTTCGCGCCCGTCCTATCGGCCACGTCCCGCGGGGTGGCGGGAG
CGCTGCGGCCCCTGCTGCAAAGCGCGGTGCCCGCCACCTCGGAACCACCGGTTCTGGACGTGAA
GCGACCCTTCCTGTGCCGTGAGTCGCTGAGTGGCCAGGCCGCGACCCGTCCTTTGGTGGCCACA
GTGGGCCTGAATGTTCCTGCTTCTGTTCGTTATTCCCACACAGACATCAAGGTGCCCGACTTCT
CTGACTATCGCCGTGCTGAAGTTCTAGATAGCACAAAATCTTCTAAAGAGAGCAGTGAGGCTAG
AAAAGGCTTCTCTTACTTGGTAACTGCAACTACTACTGTGGGTGTTGCATACGCTGCGAAAAAT
GCAGTCTCCCAGTTTGTTTCCAGCATGAGTGCTTCTGCGGATGTACTGGCCATGTCGAAGATCG
AGATCAAGTTGTCTGATATTCCAGAGGGGAAGAACATGGCTTTTAAATGGAGAGGCAAACCTCT
GTTTGTGCGCCATAGAACCAAGAAGGAGATTGACCAGGAAGCTGCAGTTGAAGTGTCCCAGTTA
AGGGACCCACAGCATGATTTAGAGCGTGTAAAGAAGCCTGAATGGGTTATTCTGATCGGTGTCT
GTACTCATCTTGGTTGTGTACCCATTGCAAACGCAGGAGATTTTGGTGGCTACTATTGCCCCTG
CCATGGGTCACACTATGATGCTTCTGGCAGGATCAGGAAGGGCCCTGCACCTCTCAACCTGGAA
GTACCTACCTATGAGTTCACCAGTGGTGATGTAGTTGTTGTGGGTTAGACACTTGGACTCAGGG
CCTAGGTTTCTTTCGGTCTTCATGTCCCCTCAGAAGAGTTGAGAGTAAGCCTTGTGTACTTCTA
GGTTGGTTGATTTAAAATATTTAAGAATTGTTAATAACTATTGGCAAACATTAATGTGAAGTAA
TTGAATTCACTGTTGAATATTATCAAGCATTAGCATAATAAAACCACTGTTGAACATCATTAAA
AAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063276184 ⟹ XP_063132254

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	34,173,787 - 34,190,952 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001008888	(Get FASTA)	NCBI Sequence Viewer
	XP_063132254	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42051	(Get FASTA)	NCBI Sequence Viewer
	AAH85339	(Get FASTA)	NCBI Sequence Viewer
	AAS66286	(Get FASTA)	NCBI Sequence Viewer
	EDL98371	(Get FASTA)	NCBI Sequence Viewer
	EDL98372	(Get FASTA)	NCBI Sequence Viewer
	EDL98373	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024609.4
	ENSRNOP00000099852
GenBank Protein	P20788	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001008888 ⟸ NM_001008888

- UniProtKB:

Q6QI13 (UniProtKB/Swiss-Prot), P20788 (UniProtKB/Swiss-Prot), A6J7M2 (UniProtKB/TrEMBL), A6J7M3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLSVAARSGPFAPVLSATSRGVAGALRPLLQSAVPATSEPPVLDVKRPFLCRESLSGQAATRPL
VATVGLNVPASVRYSHTDIKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYA
AKNAVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEV
SQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPL
NLEVPTYEFTSGDVVVVG

hide sequence

Ensembl Acc Id:

ENSRNOP00000024609 ⟸ ENSRNOT00000024609

RefSeq Acc Id:	XP_063132254 ⟸ XM_063276184
- Peptide Label:	isoform X1
- UniProtKB:	Q6QI13 (UniProtKB/Swiss-Prot), P20788 (UniProtKB/Swiss-Prot), A6J7M3 (UniProtKB/TrEMBL), A6J7M2 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000099852 ⟸ ENSRNOT00000126950

Protein Domains

Cytochrome b-c1 complex subunit Rieske Rieske Ubiquinol-cytochrome c reductase iron-sulphur

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P20788-F1-model_v2	AlphaFold	P20788	1-274	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700427

Promoter ID:

EPDNEW_R10951

Type:

initiation region

Name:

Uqcrfs1_1

Description:

ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	35,677,970 - 35,678,030	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628838	AgrOrtholog
BioCyc Gene	G2FUF-9531	BioCyc
Ensembl Genes	ENSRNOG00000018281	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000024609.7	UniProtKB/Swiss-Prot
	ENSRNOT00000126950	ENTREZGENE
Gene3D-CATH	1.20.5.270	UniProtKB/Swiss-Prot
	2.102.10.10	UniProtKB/Swiss-Prot
	Cytochrome Bc1 Complex, Chain I	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7302533	IMAGE-MGC_LOAD
InterPro	bc1_Rieske_TM_sf	UniProtKB/Swiss-Prot
	Globular_prot_asu/bsu	UniProtKB/Swiss-Prot
	Rieske_2Fe-2S	UniProtKB/Swiss-Prot
	Rieske_2Fe-2S_sf	UniProtKB/Swiss-Prot
	Rieske_Fe-S_prot	UniProtKB/Swiss-Prot
	Rieske_Fe-S_prot_C	UniProtKB/Swiss-Prot
	Rieske_TM	UniProtKB/Swiss-Prot
	Ubiqinol_cyt_c_Rdtase_N	UniProtKB/Swiss-Prot
	Ubiquinol_cyt_c_Rdtase_Fe-S-su	UniProtKB/Swiss-Prot
KEGG Report	rno:291103	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105530	IMAGE-MGC_LOAD
NCBI Gene	Uqcrfs1	ENTREZGENE
PANTHER	PTHR10134	UniProtKB/Swiss-Prot
Pfam	Rieske	UniProtKB/Swiss-Prot
	Ubiq-Cytc-red_N	UniProtKB/Swiss-Prot
	UCR_TM	UniProtKB/Swiss-Prot
PhenoGen	Uqcrfs1	PhenoGen
PRINTS	RIESKE	UniProtKB/Swiss-Prot
PROSITE	RIESKE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018281	RatGTEx
Superfamily-SCOP	ISP transmembrane anchor	UniProtKB/Swiss-Prot
	SSF50022	UniProtKB/Swiss-Prot
	SSF56568	UniProtKB/Swiss-Prot
UniProt	A6J7M1_RAT	UniProtKB/TrEMBL
	A6J7M2	ENTREZGENE, UniProtKB/TrEMBL
	A6J7M3	ENTREZGENE, UniProtKB/TrEMBL
	P20788	ENTREZGENE
	Q6QI13	ENTREZGENE
	UCRI_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q6QI13	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-07-08	Uqcrfs1	ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1			Symbol and Name status set to approved	1299863	APPROVED
2003-02-27	Uqcrfs1	ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expressed in the liver	729966
gene_protein	predicted protein consists of 196 aa residues and masses 21.4 kDa	729966

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)