Advanced Search (OLGA)

Gene: Gab2 (GRB2-associated binding protein 2) Rattus norvegicus

Analyze

Symbol:

Gab2

Name:

GRB2-associated binding protein 2

RGD ID:

621367

Description:

Enables protein domain specific binding activity and protein phosphatase binding activity. Involved in intracellular signal transduction. Part of protein-containing complex. Orthologous to human GAB2 (GRB2 associated binding protein 2); PARTICIPATES IN Fc epsilon receptor mediated signaling pathway; granulocyte-macrophage colony-stimulating factor signaling pathway; interleukin-2 signaling pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GRB2-associated binder 2; GRB2-associated-binding protein 2; growth factor receptor bound protein 2-associated protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GAB2 (GRB2 associated binding protein 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Gab2 (growth factor receptor bound protein 2-associated protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gab2 (GRB2 associated binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GAB2 (GRB2 associated binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NARS2 (asparaginyl-tRNA synthetase 2, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gab2 (GRB2 associated binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GAB2 (GRB2 associated binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GAB2 (GRB2 associated binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gab2 (GRB2 associated binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gab2 (GRB2 associated binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GAB4 (GRB2 associated binding protein family member 4)	HGNC	OrthoDB, Panther, Treefam
Alliance orthologs ³
Mus musculus (house mouse):	Gab2 (growth factor receptor bound protein 2-associated protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GAB2 (GRB2 associated binding protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gab2 (GRB2-associated binding protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	dos	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	dos	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	soc-1	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	soc-1	Alliance	DIOPT (Ensembl Compara\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	gab2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	160,841,066 - 161,036,940 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	160,841,066 - 161,036,940 (+)	Ensembl				GRCr8
mRatBN7.2	1	151,429,844 - 151,625,708 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	151,429,695 - 151,625,031 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	159,415,950 - 159,614,017 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	166,596,124 - 166,794,193 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	159,469,621 - 159,667,696 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	162,082,876 - 162,283,379 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	162,083,030 - 162,279,727 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	168,423,264 - 168,486,051 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	154,348,777 - 154,544,906 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	149,534,433 - 149,721,184 (+)	NCBI		Celera
RGSC_v3.1	1	154,427,186 - 154,623,310 (+)	NCBI
Cytogenetic Map	1	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chronic myeloid leukemia (ISO)

melanoma (ISO)

Neoplasm Invasiveness (ISO)

Neoplasm Metastasis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

afimoxifene (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

C60 fullerene (EXP)

cadmium dichloride (ISO)

caffeine (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP,ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

diclofenac (ISO)

dicrotophos (ISO)

doxorubicin (ISO)

endosulfan (EXP)

fluoranthene (ISO)

flutamide (EXP)

FR900359 (ISO)

fulvestrant (ISO)

genistein (ISO)

gentamycin (EXP)

glyphosate (ISO)

GSK-J4 (ISO)

hydrogen peroxide (ISO)

inulin (ISO)

iron dichloride (ISO)

lead diacetate (ISO)

leflunomide (ISO)

methylglyoxal (ISO)

methylmercury chloride (ISO)

niclosamide (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

potassium chromate (ISO)

quercetin (ISO)

serpentine asbestos (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

sulforaphane (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

thymol (ISO)

thymol sulfate(1-) (ISO)

titanium dioxide (ISO)

trametinib (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

tris(2-butoxyethyl) phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

vitamin E (ISO)

xanthohumol (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell migration (ISO)

cell surface receptor protein tyrosine kinase signaling pathway (IEA)

integrin-mediated signaling pathway (ISO)

intracellular signal transduction (IDA)

osteoclast differentiation (ISO,ISS)

phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO,ISS)

positive regulation of cell population proliferation (ISO,ISS)

positive regulation of epithelial cell migration (ISO)

positive regulation of mast cell degranulation (ISO,ISS)

signal transduction (IBA,IEA)

Cellular Component

cytoplasm (IBA,IEA,ISO,ISS)

membrane raft (IEA,ISO,ISS)

plasma membrane (IEA,ISO,ISS)

protein-containing complex (IDA)

Molecular Function

phosphatidylinositol-3,4,5-trisphosphate binding (ISO,ISS)

phosphatidylinositol-3,4-bisphosphate binding (ISO,ISS)

protein binding (ISO)

protein domain specific binding (IPI)

protein phosphatase binding (IPI)

transmembrane receptor protein tyrosine kinase adaptor activity (IBA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

chronic myeloid leukemia pathway (IEA)

Fc epsilon receptor mediated signaling pathway (IEA,ISO)

Fc gamma receptor mediated signaling pathway (IEA)

granulocyte-macrophage colony-stimulating factor signaling pathway (ISO)

interleukin-2 signaling pathway (ISO)

interleukin-3 signaling pathway (ISO)

interleukin-6 signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The tyrosine phosphatase Shp-2 mediates intracellular signaling initiated by Ret mutants.	D'Alessio A, etal., Endocrinology. 2003 Oct;144(10):4298-305. Epub 2003 Jun 19.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Epidermal growth factor-induced phosphatidylinositol 3-kinase activation and DNA synthesis. Identification of Grb2-associated binder 2 as the major mediator in rat hepatocytes.	Kong M, etal., J Biol Chem. 2000 Nov 17;275(46):36035-42.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Gab2 signaling in chronic myeloid leukemia cells confers resistance to multiple Bcr-Abl inhibitors.	Wöhrle FU, etal., Leukemia. 2013 Jan;27(1):118-29. doi: 10.1038/leu.2012.222. Epub 2012 Aug 3.
14.	Comparative FISH mapping of Gab1 and Gab2 genes in human, mouse and rat.	Yamada K, etal., Cytogenet Cell Genet 2001;94(1-2):39-42.

Additional References at PubMed

PMID:11449275	PMID:11895767	PMID:12595575	PMID:14604964	PMID:15162432	PMID:15750601	PMID:16456001	PMID:19118509	PMID:19172738	PMID:23045700	PMID:23401857

Genomics

Comparative Map Data

Gab2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	160,841,066 - 161,036,940 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	160,841,066 - 161,036,940 (+)	Ensembl				GRCr8
mRatBN7.2	1	151,429,844 - 151,625,708 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	151,429,695 - 151,625,031 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	159,415,950 - 159,614,017 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	166,596,124 - 166,794,193 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	159,469,621 - 159,667,696 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	162,082,876 - 162,283,379 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	162,083,030 - 162,279,727 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	168,423,264 - 168,486,051 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	154,348,777 - 154,544,906 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	149,534,433 - 149,721,184 (+)	NCBI		Celera
RGSC_v3.1	1	154,427,186 - 154,623,310 (+)	NCBI
Cytogenetic Map	1	q32	NCBI

GAB2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	78,215,293 - 78,417,820 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	78,215,293 - 78,418,348 (-)	Ensembl			hg38	GRCh38
GRCh37	11	77,926,339 - 78,128,866 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	77,603,990 - 77,806,414 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	11	77,603,989 - 77,806,414	NCBI
Celera	11	75,234,820 - 75,437,334 (-)	NCBI		Celera
Cytogenetic Map	11	q14.1	NCBI
HuRef	11	74,223,774 - 74,350,451 (-)	NCBI		HuRef
CHM1_1	11	77,809,494 - 78,012,010 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	78,148,579 - 78,351,115 (-)	NCBI		T2T-CHM13v2.0

Gab2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	96,730,958 - 96,958,158 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	96,730,793 - 96,958,153 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	97,081,751 - 97,308,951 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	97,081,586 - 97,308,946 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	104,230,261 - 104,457,461 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	86,817,681 - 87,047,535 (+)	NCBI		MGSCv36	mm8
MGSCv36	7	96,956,943 - 97,180,228 (+)	NCBI		MGSCv36	mm8
Cytogenetic Map	7	E1	NCBI
cM Map	7	53.39	NCBI

Gab2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955414	13,679,588 - 13,751,079 (+)	Ensembl
ChiLan1.0	NW_004955414	13,640,713 - 13,754,401 (+)	NCBI	ChiLan1.0	ChiLan1.0

GAB2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	79,148,122 - 79,351,393 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	80,192,030 - 80,395,201 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	73,275,360 - 73,478,272 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	76,896,691 - 76,965,955 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	76,896,691 - 76,967,007 (-)	Ensembl			panPan2	panpan1.1

NARS2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	20,277,707 - 20,413,624 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	20,277,507 - 20,606,736 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	20,172,632 - 20,308,737 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	20,480,690 - 20,616,549 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	21	20,480,413 - 20,624,453 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	21	20,258,355 - 20,393,504 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	20,472,646 - 20,608,490 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	20,396,339 - 20,532,773 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gab2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	65,175,561 - 65,236,040 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936498	6,778,462 - 6,835,643 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936498	6,775,170 - 6,835,680 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GAB2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	12,663,657 - 12,851,342 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	12,663,658 - 12,851,423 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	13,937,322 - 14,135,579 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GAB2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	69,422,517 - 69,624,411 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	69,424,100 - 69,624,279 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666043	56,115,569 - 56,326,011 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gab2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624863	1,219,866 - 1,281,847 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624863	1,216,664 - 1,410,934 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gab2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	95,460,302 - 95,631,441 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gab2
1559 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	62
Count of miRNA genes:	59
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000016361
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	131179947	176179947	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	137611478	182611478	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	153679879	198679879	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	132760429	191848948	Rat
631684	Bp117	Blood pressure QTL 117	8.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	120082258	165082258	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	153679879	205813246	Rat
8694166	Bw147	Body weight QTL 147	6.83	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	1	153788989	198788989	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	142582336	182383862	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	160573753	210707719	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	139442053	223964440	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	160573753	210707719	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	127329268	206393015	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	159894717	207261263	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	109493780	193400781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	146080545	243492863	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	141173126	169168317	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	155359438	194575574	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	140833106	185833106	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	153679879	232414077	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	160574007	235238518	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	116099376	191260518	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	131243790	176243790	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
737974	Bp161	Blood pressure QTL 161		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	129182274	174182274	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	132760429	191848948	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	115183611	176289080	Rat
634315	Niddm45	Non-insulin dependent diabetes mellitus QTL 45	7.16		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	153680016	182383862	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
61379	Bp44	Blood pressure QTL 44	19.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	153680016	183564652	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	102780511	182384005	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	128019551	173019551	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	139442053	223964440	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	178317588	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	210707719	Rat
8693608	Alc24	Alcohol consumption QTL 24	2.3	0.74	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	159863716	177663210	Rat
1576310	Schws2	Schwannoma susceptibility QTL 2		0.029	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	1	153788989	198788989	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	180021436	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	191190115	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	132966869	206393015	Rat
631548	Bp88	Blood pressure QTL 88	5	0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	140915717	185915717	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	132760429	191848948	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat
7411599	Foco11	Food consumption QTL 11	18.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	1	153788989	198788989	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	210707719	Rat

Markers in Region

AI012296

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	151,562,973 - 151,563,191 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	162,217,528 - 162,217,745	NCBI	Rnor6.0
Rnor_5.0	1	168,429,795 - 168,430,012	UniSTS	Rnor5.0
RGSC_v3.4	1	154,483,753 - 154,483,970	UniSTS	RGSC3.4
Celera	1	149,666,814 - 149,667,031	UniSTS
RH 3.4 Map	1	1170.6	UniSTS
Cytogenetic Map	1	q33.2-q33.3	UniSTS

RH139114

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	151,517,976 - 151,518,096 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	162,173,011 - 162,173,130	NCBI	Rnor6.0
Rnor_5.0	1	168,385,278 - 168,385,397	UniSTS	Rnor5.0
RGSC_v3.4	1	154,437,513 - 154,437,632	UniSTS	RGSC3.4
Celera	1	149,621,765 - 149,621,884	UniSTS
RH 3.4 Map	1	1171.0	UniSTS
Cytogenetic Map	1	q33.2-q33.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053417	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017589791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC125702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF230367	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016361 ⟹ ENSRNOP00000016361

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	160,841,066 - 161,036,940 (+)	Ensembl
mRatBN7.2 Ensembl	1	151,429,695 - 151,625,031 (+)	Ensembl
Rnor_6.0 Ensembl	1	162,083,030 - 162,279,727 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000173973 ⟹ ENSRNOP00000102661

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	160,858,881 - 161,033,364 (+)	Ensembl

RefSeq Acc Id:

NM_053417 ⟹ NP_445869

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	160,841,066 - 161,036,940 (+)	NCBI
mRatBN7.2	1	151,429,844 - 151,625,708 (+)	NCBI
Rnor_6.0	1	162,083,038 - 162,279,527 (+)	NCBI
Rnor_5.0	1	168,423,264 - 168,486,051 (+)	NCBI
RGSC_v3.4	1	154,348,777 - 154,544,906 (+)	RGD
Celera	1	149,534,433 - 149,721,184 (+)	NCBI

Sequence:

show sequence

ATGAGCGGCGGCGGCGGCGACGACGTGGTGTGTACCGGCTGGCTGAGGAAATCGCCTCCGGAAA
AGAAGTTGAGGCGCTATGCCTGGAAGAAACGCTGGTTTATACTGCGGAGTGGCCGGATGAGTGG
AGACCCAGATGTTCTGGAATACTACAAGAATGAGCACTCCAAGAAACCCCTGCGGATCATCAAC
CTGAACTTCTGTGAGCAGGTGGATGCAGGCCTGACCTTCAACAAGAAAGAGCTACAGGATAGCT
TTGTGTTTGATATCAAGACCAGCGAGCGCACGTTTTACCTGGTGGCTGAGACGGAGGCTGACAT
GAACAAGTGGGTCCAGAGCATCTGCCAGATTTGCGGTTTCAATCAAGCCGAAGAGAGCACAGAC
TCCCTGAGGAACCTTTCTTCAGCCAGTCACGGTCCCCGCTCCTCTCCAGCTGAGTTCAGCTCCA
GTCAGCACCTGCTCCGAGAACGGAAGTCCTCAGCCCCTTCACACTCTAGCCAGCCCACTTTATT
CACATTTGAGCCCCCTATGACAAGCCACATGCAGCCTGCCTTGTCCACCAGTGCACCTCAGGAG
TATCTCTACTTGCACCAGTGCATAAGCAGAAGGACAGAAAACTCAAGGAGTGCCAGCTTCTCTC
AGGGCACCCGGCAGAAGAGTGATACAGCCGTGCAAAAACTTGCCCAGAGCAATGGACACTGTAT
CAATGGAGTCAGCAATCAAGTCCATGGTTTCTATAGCCTTCCCAAGCCAAGCCGACACAATACA
GAATTCAAAGACAGTACTTATGATCTCCCGAGGAGCCTGGCGTCACATGGCCACACCAAGAGCA
GCCTCACAGGGTCTGAGACTGATAACGAGGATGTGTATACCTTCAAGATGCCCAGCAACACCCT
GTGTCGGGAGTTTGGAGACCTCCTTGTGGACAATATGGATGTTCCAACCACCCCTCTCTCAGCC
TACCAGATCCCTAGAACATTTACACTGGACAAGAATCACAATGCCATGACAGTGGCCACTTCTG
GAGACTCAGCCATAGCTCCCCCACCCCGGCCACCCAAGCCAAGTCAAGCAGAAACACCTCGATG
GGGCAGCCCTCAGCAAAAACCTCCGATCGGCGAGAATAGCAGATCTGTAGCTGCTACTATCCCC
AGGCGCAATACCCTCCCTGCAATGGACAACAGCCGGCTCCACCGAGCTTCCTCCTGTGAGACCT
ATGAATACCCAACACGAGGCAGCGGAGAGAGTGCCAGCTGGTCTGCTGAATCTCCAGGAAAGAC
TGCCGTGGGTCGATCAGACAGTGCCAGCTCTGATGAAAATTACGTGCCCATGAACCCAGGTTCT
TCTACCCTGCTGGCCATGGAACGAGCCGGGGACAATTCCCAGAGTGCCTACATACCCATGGGCC
CAGGGCCTCATCACTTTGATCCACTTGGGTACCCATCCACAGCCCTTCCTATTCACAGAGGCCC
CAGCCGAGGAAGTGAGATCCAGCCACCCCCAGTCAACCGAAACCTCAAACCTGACCGAAAAGCA
AAGCCAACACCCCTTGACCTGAGAAACAACACTGTCATCGATGAGCTCCCCTTCAAGTCACCTG
TCACCAAGTCTTGGTCCAGGATCAACCACACCTTTAACTCCAGTTCCTCCCAGTACTGCCGTCC
TATCTCCACACAGAGCATCACCAGCACAGACTCAGGAGACAGTGAGGAGAACTATGTCCCTATG
CAAAACCCAGTATCTGCGTCCCCTGTTCCCAGTGGCACTAACAGCCCAGCTCCCAGGAAGAGTA
CTGGCAGTGTGGATTACCTAGCCCTGGACTTCCAGCCGGGCTCCCCAAGCCCTCACCGCAAGCC
ATCCACATCATCTGTCACATCGGATGAGAAGGTAGACTATGTCCAAGTGGATAAAGAGAAGACA
CAGGCCCTGCAGAACACCATGCAGGAGTGGACAGATGTACGGCAGTCCTCAGAACCTTCCAAGG
GTGCCAAGCTGTAATAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_445869	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG44268	(Get FASTA)	NCBI Sequence Viewer
	EDM18499	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016361
GenBank Protein	Q9EQH1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445869 ⟸ NM_053417

- UniProtKB:

Q9EQH1 (UniProtKB/Swiss-Prot), F1LSR2 (UniProtKB/TrEMBL), A6I681 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSGGGGDDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNEHSKKPLRIIN
LNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEADMNKWVQSICQICGFNQAEESTD
SLRNLSSASHGPRSSPAEFSSSQHLLRERKSSAPSHSSQPTLFTFEPPMTSHMQPALSTSAPQE
YLYLHQCISRRTENSRSASFSQGTRQKSDTAVQKLAQSNGHCINGVSNQVHGFYSLPKPSRHNT
EFKDSTYDLPRSLASHGHTKSSLTGSETDNEDVYTFKMPSNTLCREFGDLLVDNMDVPTTPLSA
YQIPRTFTLDKNHNAMTVATSGDSAIAPPPRPPKPSQAETPRWGSPQQKPPIGENSRSVAATIP
RRNTLPAMDNSRLHRASSCETYEYPTRGSGESASWSAESPGKTAVGRSDSASSDENYVPMNPGS
STLLAMERAGDNSQSAYIPMGPGPHHFDPLGYPSTALPIHRGPSRGSEIQPPPVNRNLKPDRKA
KPTPLDLRNNTVIDELPFKSPVTKSWSRINHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPM
QNPVSASPVPSGTNSPAPRKSTGSVDYLALDFQPGSPSPHRKPSTSSVTSDEKVDYVQVDKEKT
QALQNTMQEWTDVRQSSEPSKGAKL

hide sequence

Ensembl Acc Id:

ENSRNOP00000016361 ⟸ ENSRNOT00000016361

Ensembl Acc Id:

ENSRNOP00000102661 ⟸ ENSRNOT00000173973

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EQH1-F1-model_v2	AlphaFold	Q9EQH1	1-665	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690202

Promoter ID:

EPDNEW_R727

Type:

initiation region

Name:

Gab2_1

Description:

GRB2-associated binding protein 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	162,082,948 - 162,083,008	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621367	AgrOrtholog
BioCyc Gene	G2FUF-58454	BioCyc
Ensembl Genes	ENSRNOG00000011882	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000016361	ENTREZGENE
Gene3D-CATH	2.30.29.30	UniProtKB/Swiss-Prot
InterPro	Gab1-4-like	UniProtKB/Swiss-Prot
	PH-like_dom_sf	UniProtKB/Swiss-Prot
	PH_domain	UniProtKB/Swiss-Prot
KEGG Report	rno:84477	UniProtKB/Swiss-Prot
NCBI Gene	84477	ENTREZGENE
PANTHER	GRB2-ASSOCIATED-BINDING PROTEIN 2	UniProtKB/Swiss-Prot
	PTHR45960	UniProtKB/Swiss-Prot
Pfam	PF00169	UniProtKB/Swiss-Prot
PhenoGen	Gab2	PhenoGen
PROSITE	PH_DOMAIN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011882	RatGTEx
SMART	SM00233	UniProtKB/Swiss-Prot
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot
UniProt	A0ABK0LBL6_RAT	UniProtKB/TrEMBL
	A6I681	ENTREZGENE, UniProtKB/TrEMBL
	F1LSR2	ENTREZGENE, UniProtKB/TrEMBL
	GAB2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-19	Gab2	GRB2-associated binding protein 2	Gab2	growth factor receptor bound protein 2-associated protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Gab2	growth factor receptor bound protein 2-associated protein 2		GRB2-associated binding protein 2	Name updated	1299863	APPROVED
2002-08-07	Gab2	GRB2-associated binding protein 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_mapping	mapped to chromosome 1q33.2-->q33.3	632794

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)