Symbol:
Ilk
Name:
integrin-linked kinase
RGD ID:
620063
Description:
Enables SH3 domain binding activity; integrin binding activity; and protein kinase activity. Involved in several processes, including negative regulation of apoptotic process; positive regulation of cell differentiation; and regulation of protein kinase activity. Located in several cellular components, including costamere; dendritic shaft; and focal adhesion. Part of protein-containing complex. Human ortholog(s) of this gene implicated in pancreatic cancer. Orthologous to human ILK (integrin linked kinase); PARTICIPATES IN integrin mediated signaling pathway; altered integrin mediated signaling pathway; pancreatic cancer pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
59 kDa serine/threonine-protein kinase; beta-integrin-linked kinase; ILK-1; ILK-2; inactive integrin-linked kinase; integrin linked kinase; integrin-linked protein kinase; p59ILK; scaffold protein ILK
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ILK (integrin linked kinase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ilk (integrin linked kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ilk (integrin linked kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ILK (integrin linked kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ILK (integrin linked kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ilk (integrin linked kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ILK (integrin linked kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ILK (integrin linked kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ilk (integrin linked kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TAF10 (TATA-box binding protein associated factor 10) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
ILK (integrin linked kinase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ilk (integrin linked kinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ilk (integrin-linked kinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pat-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ilk
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ilk
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 169,500,716 - 169,506,972 (+) NCBI GRCr8 mRatBN7.2 1 160,088,839 - 160,095,140 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 160,088,897 - 160,095,140 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 168,111,452 - 168,117,707 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 175,297,450 - 175,303,706 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 168,199,208 - 168,205,462 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 170,578,941 - 170,585,192 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 170,578,889 - 170,585,189 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 177,584,793 - 177,591,044 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 163,481,299 - 163,487,550 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 163,576,775 - 163,583,027 (+) NCBI Celera 1 158,020,986 - 158,027,237 (+) NCBI Celera Cytogenetic Map 1 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ilk Rat (+)-pilocarpine decreases activity ISO Ilk (Mus musculus) 6480464 Pilocarpine results in decreased activity of ILK protein CTD PMID:19631748 Ilk Rat 1,2-dimethylhydrazine increases expression ISO Ilk (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ILK mRNA CTD PMID:22206623 Ilk Rat 17alpha-ethynylestradiol affects expression ISO Ilk (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ILK mRNA CTD PMID:17555576 Ilk Rat 17beta-estradiol multiple interactions ISO ILK (Homo sapiens) 6480464 Estradiol promotes the reaction [ESR1 protein binds to ILK protein] CTD PMID:29389661 and PMID:32088792 Ilk Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ILK protein CTD PMID:32145629 Ilk Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO ILK (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ilk Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO ILK (Homo sapiens) 6480464 2 more ... CTD PMID:37385330 Ilk Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ilk (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ILK mRNA CTD PMID:19465110 Ilk Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ILK mRNA CTD PMID:34747641 Ilk Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ilk (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ILK mRNA CTD PMID:21570461 Ilk Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ILK mRNA CTD PMID:21346803 Ilk Rat 2,6-di-tert-butyl-4-methylphenol multiple interactions ISO Ilk (Mus musculus) 6480464 [Butylated Hydroxytoluene co-treated with Oxygen] results in increased expression of ILK protein CTD PMID:16272459 Ilk Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ILK mRNA CTD PMID:21346803 Ilk Rat 2-nitrotoluene decreases expression EXP 6480464 2-nitrotoluene results in decreased expression of ILK mRNA CTD PMID:16460773 Ilk Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine multiple interactions EXP 6480464 mizoribine inhibits the reaction [Puromycin Aminonucleoside results in increased activity of ILK protein] CTD PMID:20502051 Ilk Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine increases activity EXP 6480464 Puromycin Aminonucleoside results in increased activity of ILK protein CTD PMID:20502051 Ilk Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ILK (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ILK mRNA CTD PMID:28628672 Ilk Rat 4,4'-sulfonyldiphenol decreases methylation ISO ILK (Homo sapiens) 6480464 bisphenol S results in decreased methylation of ILK gene CTD PMID:31601247 Ilk Rat 4,4'-sulfonyldiphenol increases expression ISO ILK (Homo sapiens) 6480464 bisphenol S results in increased expression of ILK protein CTD PMID:34186270 Ilk Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ILK mRNA CTD PMID:30047161 Ilk Rat acetylsalicylic acid decreases activity ISO ILK (Homo sapiens) 6480464 Aspirin results in decreased activity of ILK protein CTD PMID:11593435 Ilk Rat acetylsalicylic acid decreases expression ISO ILK (Homo sapiens) 6480464 Aspirin results in decreased expression of ILK mRNA CTD PMID:15928584 Ilk Rat all-trans-retinoic acid increases expression ISO ILK (Homo sapiens) 6480464 Tretinoin results in increased expression of ILK mRNA CTD PMID:15498508 Ilk Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of ILK mRNA CTD PMID:30047161 Ilk Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ILK mRNA CTD PMID:16483693 Ilk Rat azoxystrobin decreases expression ISO ILK (Homo sapiens) 6480464 azoxystrobin results in decreased expression of ILK mRNA CTD PMID:33512557 Ilk Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of ILK mRNA CTD PMID:20920545 Ilk Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ILK mRNA CTD PMID:25181051 Ilk Rat bisphenol A multiple interactions ISO Ilk (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of ILK protein CTD PMID:35999755 Ilk Rat bisphenol A decreases expression ISO Ilk (Mus musculus) 6480464 bisphenol A results in decreased expression of ILK protein CTD PMID:35999755 Ilk Rat bisphenol A increases expression ISO ILK (Homo sapiens) 6480464 bisphenol A results in increased expression of ILK protein CTD PMID:37567409 Ilk Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ILK protein CTD PMID:32145629 Ilk Rat bisphenol A decreases expression ISO ILK (Homo sapiens) 6480464 bisphenol A results in decreased expression of ILK mRNA and bisphenol A results in decreased expression of ILK protein CTD PMID:29275510 and PMID:34186270 Ilk Rat bisphenol A multiple interactions ISO ILK (Homo sapiens) 6480464 [bisphenol A binds to and affects the folding of AR protein] inhibits the reaction [AR protein modified form binds to ILK protein modified form] CTD PMID:28751236 Ilk Rat bisphenol AF increases expression ISO ILK (Homo sapiens) 6480464 bisphenol AF results in increased expression of ILK protein CTD PMID:34186270 Ilk Rat bisphenol AF multiple interactions ISO ILK (Homo sapiens) 6480464 [bisphenol AF binds to and affects the folding of AR protein] inhibits the reaction [AR protein modified form binds to ILK protein modified form] CTD PMID:28751236 Ilk Rat Bisphenol B increases expression ISO ILK (Homo sapiens) 6480464 bisphenol B results in increased expression of ILK protein CTD PMID:34186270 Ilk Rat bisphenol F multiple interactions ISO ILK (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ILK mRNA CTD PMID:28628672 Ilk Rat bromochloroacetic acid decreases expression EXP 6480464 bromochloroacetic acid results in decreased expression of ILK mRNA CTD PMID:16460773 Ilk Rat cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of ILK mRNA CTD PMID:17327699 Ilk Rat cadmium atom affects expression ISO ILK (Homo sapiens) 6480464 Cadmium affects the expression of ILK mRNA CTD PMID:31082282 Ilk Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of ILK mRNA CTD PMID:17327699 Ilk Rat carbon nanotube affects expression ISO Ilk (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of ILK protein CTD PMID:21135415 Ilk Rat CGP 52608 multiple interactions ISO ILK (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ILK gene] CTD PMID:28238834 Ilk Rat chlorpyrifos decreases expression ISO Ilk (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of ILK mRNA CTD PMID:32715474 Ilk Rat cobalt dichloride decreases expression ISO ILK (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ILK mRNA CTD PMID:19320972 Ilk Rat cocaine multiple interactions EXP 6480464 Cocaine affects the reaction [ILK protein affects the phosphorylation of AKT1 protein] more ... CTD PMID:18702665 and PMID:19629758 Ilk Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of ILK protein CTD PMID:18702665 Ilk Rat copper(II) sulfate decreases expression ISO ILK (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ILK mRNA CTD PMID:19549813 Ilk Rat crocidolite asbestos increases expression EXP 6480464 Asbestos and Crocidolite results in increased expression of ILK mRNA CTD PMID:10783328 Ilk Rat cyclosporin A increases expression ISO ILK (Homo sapiens) 6480464 Cyclosporine results in increased expression of ILK mRNA CTD PMID:25562108 Ilk Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of ILK mRNA CTD PMID:22528246 Ilk Rat dexamethasone multiple interactions ISO ILK (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ILK mRNA CTD PMID:28628672 Ilk Rat dextran sulfate decreases expression ISO Ilk (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of ILK protein CTD PMID:35999755 Ilk Rat dextran sulfate multiple interactions ISO Ilk (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of ILK protein CTD PMID:35999755 Ilk Rat dibutyl phthalate increases expression ISO Ilk (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ILK mRNA CTD PMID:21266533 Ilk Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ILK mRNA CTD PMID:21266533 Ilk Rat diethylstilbestrol multiple interactions ISO ILK (Homo sapiens) 6480464 Diethylstilbestrol promotes the reaction [ESR1 protein binds to ILK protein] CTD PMID:32088792 Ilk Rat dioxygen multiple interactions ISO Ilk (Mus musculus) 6480464 [Butylated Hydroxytoluene co-treated with Oxygen] results in increased expression of ILK protein CTD PMID:16272459 Ilk Rat doxorubicin increases oxidation EXP 6480464 Doxorubicin results in increased oxidation of ILK protein CTD PMID:28818578 Ilk Rat doxorubicin increases expression ISO ILK (Homo sapiens) 6480464 Doxorubicin results in increased expression of ILK mRNA CTD PMID:29803840 Ilk Rat elemental selenium increases expression ISO ILK (Homo sapiens) 6480464 Selenium results in increased expression of ILK mRNA CTD PMID:19244175 Ilk Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ILK mRNA CTD PMID:29391264 Ilk Rat ethanol decreases activity EXP 11080685 prenatal alcohol exposure decreases enzyme activity of ILK in rat hippocampus lysate RGD Ilk Rat ethyl trans-caffeate affects expression ISO ILK (Homo sapiens) 6480464 ethyl caffeate affects the expression of ILK protein CTD PMID:24892518 Ilk Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of ILK mRNA CTD PMID:18035473 Ilk Rat FR900359 decreases phosphorylation ISO ILK (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of ILK protein CTD PMID:37730182 Ilk Rat gemcitabine affects response to substance ISO ILK (Homo sapiens) 6480464 ILK protein affects the susceptibility to Gemcitabine CTD PMID:15867245 Ilk Rat genistein decreases expression ISO ILK (Homo sapiens) 6480464 Genistein results in decreased expression of ILK mRNA CTD PMID:22228119 Ilk Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ILK mRNA CTD PMID:22061828 Ilk Rat hydrogen peroxide multiple interactions ISO ILK (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of ILK protein CTD PMID:18951874 Ilk Rat indometacin multiple interactions ISO ILK (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ILK mRNA CTD PMID:28628672 Ilk Rat ivermectin decreases expression ISO ILK (Homo sapiens) 6480464 Ivermectin results in decreased expression of ILK protein CTD PMID:32959892 Ilk Rat lead diacetate affects expression EXP 6480464 lead acetate affects the expression of ILK protein CTD PMID:36539177 Ilk Rat linsidomine increases oxidation EXP 6480464 linsidomine results in increased oxidation of ILK protein CTD PMID:28086193 Ilk Rat Mizoribine multiple interactions EXP 6480464 mizoribine inhibits the reaction [Puromycin Aminonucleoside results in increased activity of ILK protein] CTD PMID:20502051 Ilk Rat N-Vinyl-2-pyrrolidone multiple interactions EXP 6480464 [N-vinyl-2-pyrrolidinone binds to N-vinyl-2-pyrrolidinone] which results in increased expression of ILK mRNA CTD PMID:22037397 Ilk Rat notoginsenoside R1 multiple interactions EXP 6480464 notoginsenoside R1 inhibits the reaction [Streptozocin results in increased activity of ILK protein] CTD PMID:25503068 Ilk Rat ouabain decreases expression ISO ILK (Homo sapiens) 6480464 Ouabain results in decreased expression of ILK mRNA CTD PMID:28795476 Ilk Rat paracetamol decreases expression ISO ILK (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ILK mRNA CTD PMID:21420995 Ilk Rat phenobarbital affects response to substance ISO Ilk (Mus musculus) 6480464 ILK affects the susceptibility to Phenobarbital CTD PMID:19920070 Ilk Rat phenylephrine multiple interactions ISO Ilk (Mus musculus) 6480464 Phenylephrine affects the reaction [ANGPT1 protein results in increased expression of ILK protein] CTD PMID:18502941 Ilk Rat phenylephrine affects localization EXP 6480464 Phenylephrine affects the localization of ILK protein CTD PMID:16170337 Ilk Rat phenylephrine multiple interactions EXP 6480464 ILK protein affects the reaction [Phenylephrine results in increased expression of NPPA mRNA] CTD PMID:16170337 Ilk Rat picoxystrobin decreases expression ISO ILK (Homo sapiens) 6480464 picoxystrobin results in decreased expression of ILK mRNA CTD PMID:33512557 Ilk Rat pioglitazone decreases expression ISO ILK (Homo sapiens) 6480464 Pioglitazone results in decreased expression of ILK mRNA CTD PMID:32589349 Ilk Rat pirinixic acid multiple interactions ISO ILK (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of ILK mRNA CTD PMID:19710929 Ilk Rat Propiverine affects binding EXP 6480464 propiverine binds to ILK protein CTD PMID:29273565 Ilk Rat pyrimidifen decreases expression ISO ILK (Homo sapiens) 6480464 pyrimidifen results in decreased expression of ILK mRNA CTD PMID:33512557 Ilk Rat rotenone decreases expression ISO ILK (Homo sapiens) 6480464 Rotenone results in decreased expression of ILK mRNA CTD PMID:33512557 Ilk Rat selenium atom increases expression ISO ILK (Homo sapiens) 6480464 Selenium results in increased expression of ILK mRNA CTD PMID:19244175 Ilk Rat sodium arsenate increases expression EXP 6480464 sodium arsenate results in increased expression of ILK mRNA and sodium arsenate results in increased expression of ILK protein CTD PMID:14713550 Ilk Rat sodium arsenite decreases expression ISO ILK (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ILK mRNA CTD PMID:10910055 Ilk Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of ILK protein CTD PMID:29459688 Ilk Rat streptozocin increases activity EXP 6480464 Streptozocin results in increased activity of ILK protein CTD PMID:25503068 Ilk Rat streptozocin multiple interactions EXP 6480464 notoginsenoside R1 inhibits the reaction [Streptozocin results in increased activity of ILK protein] CTD PMID:25503068 Ilk Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of ILK mRNA CTD PMID:30047161 Ilk Rat sulindac decreases activity ISO ILK (Homo sapiens) 6480464 Sulindac results in decreased activity of ILK protein CTD PMID:11593435 Ilk Rat sunitinib decreases expression ISO ILK (Homo sapiens) 6480464 Sunitinib results in decreased expression of ILK mRNA CTD PMID:31533062 Ilk Rat tamibarotene increases expression ISO ILK (Homo sapiens) 6480464 tamibarotene results in increased expression of ILK mRNA CTD PMID:15498508 Ilk Rat tamoxifen affects expression ISO Ilk (Mus musculus) 6480464 Tamoxifen affects the expression of ILK mRNA CTD PMID:17555576 Ilk Rat tamoxifen multiple interactions ISO ILK (Homo sapiens) 6480464 Tamoxifen inhibits the reaction [ESR1 protein binds to ILK protein] CTD PMID:23665804 Ilk Rat temozolomide decreases expression ISO ILK (Homo sapiens) 6480464 Temozolomide results in decreased expression of ILK mRNA CTD PMID:31758290 Ilk Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ILK protein CTD PMID:16941698 Ilk Rat tetrachloromethane increases activity EXP 6480464 Carbon Tetrachloride results in increased activity of ILK protein CTD PMID:16941698 Ilk Rat theophylline multiple interactions ISO ILK (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of ILK protein CTD PMID:18951874 Ilk Rat triptonide affects expression ISO Ilk (Mus musculus) 6480464 triptonide affects the expression of ILK mRNA CTD PMID:33045310 Ilk Rat vitamin E increases expression ISO ILK (Homo sapiens) 6480464 Vitamin E results in increased expression of ILK mRNA CTD PMID:19244175 Ilk Rat zinc atom decreases expression ISO ILK (Homo sapiens) 6480464 Zinc results in decreased expression of ILK mRNA CTD PMID:19071009 Ilk Rat zinc(0) decreases expression ISO ILK (Homo sapiens) 6480464 Zinc results in decreased expression of ILK mRNA CTD PMID:19071009
Imported Annotations - KEGG (archival)
(+)-pilocarpine (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-di-tert-butyl-4-methylphenol (ISO) 2,6-dinitrotoluene (EXP) 2-nitrotoluene (EXP) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetylsalicylic acid (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) azoxystrobin (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bromochloroacetic acid (EXP) cadmium atom (EXP,ISO) cadmium dichloride (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cobalt dichloride (ISO) cocaine (EXP) copper(II) sulfate (ISO) crocidolite asbestos (EXP) cyclosporin A (ISO) cypermethrin (EXP) dexamethasone (ISO) dextran sulfate (ISO) dibutyl phthalate (EXP,ISO) diethylstilbestrol (ISO) dioxygen (ISO) doxorubicin (EXP,ISO) elemental selenium (ISO) endosulfan (EXP) ethanol (EXP) ethyl trans-caffeate (ISO) flavonoids (EXP) FR900359 (ISO) gemcitabine (ISO) genistein (ISO) gentamycin (EXP) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) lead diacetate (EXP) linsidomine (EXP) Mizoribine (EXP) N-Vinyl-2-pyrrolidone (EXP) notoginsenoside R1 (EXP) ouabain (ISO) paracetamol (ISO) phenobarbital (ISO) phenylephrine (EXP,ISO) picoxystrobin (ISO) pioglitazone (ISO) pirinixic acid (ISO) Propiverine (EXP) pyrimidifen (ISO) rotenone (ISO) selenium atom (ISO) sodium arsenate (EXP) sodium arsenite (EXP,ISO) streptozocin (EXP) sulfadimethoxine (EXP) sulindac (ISO) sunitinib (ISO) tamibarotene (ISO) tamoxifen (ISO) temozolomide (ISO) tetrachloromethane (EXP) theophylline (ISO) triptonide (ISO) vitamin E (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
branching involved in ureteric bud morphogenesis (IEA,ISO) caveola assembly (IEA,ISO,ISS) cell differentiation (IBA) cell morphogenesis (IEA,ISO) cell population proliferation (IEA,ISO) cell projection organization (IEA,ISO) cell-matrix adhesion (IBA) establishment or maintenance of epithelial cell apical/basal polarity (IEA,ISO) fibroblast migration (IEA,ISO) integrin-mediated signaling pathway (IBA,IEA,IMP,ISO) mitotic spindle organization (IEA,ISO,ISS) myelination in peripheral nervous system (IEA,ISO) negative regulation of apoptotic process (IMP) negative regulation of cardiac muscle cell apoptotic process (IMP) negative regulation of neural precursor cell proliferation (IEA,ISO) negative regulation of neuron apoptotic process (IMP) negative regulation of protein kinase activity (IMP) negative regulation of smooth muscle cell migration (IMP) negative regulation of smooth muscle cell proliferation (IMP) nerve development (IEA,ISO) neural precursor cell proliferation (IEA,ISO) neuron projection morphogenesis (IMP) outflow tract morphogenesis (IEA,ISO) peptidyl-serine phosphorylation (ISO) phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO) platelet aggregation (ISO) positive regulation of axon extension (IMP) positive regulation of axonogenesis (IMP) positive regulation of BMP signaling pathway (IEA,ISO) positive regulation of canonical NF-kappaB signal transduction (IEA,ISO) positive regulation of canonical Wnt signaling pathway (IEA,ISO) positive regulation of cell migration (IMP) positive regulation of cell population proliferation (IEA,IMP,ISO) positive regulation of cell-matrix adhesion (IMP) positive regulation of cellular senescence (IMP) positive regulation of dendrite morphogenesis (IMP) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of MAP kinase activity (IMP) positive regulation of MAPK cascade (IMP) positive regulation of myoblast differentiation (IMP) positive regulation of osteoblast differentiation (IEA,ISO) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IMP) positive regulation of signal transduction (IEA,ISO) positive regulation of substrate adhesion-dependent cell spreading (IEA,ISO) protein localization to cell cortex (IEA,ISO,ISS) protein phosphorylation (IDA) regulation of actin cytoskeleton organization (IMP) regulation of cell growth (IMP) Schwann cell development (IEA,ISO) substrate adhesion-dependent cell spreading (IBA,IEA,IMP,ISO) supramolecular fiber organization (IMP) tumor necrosis factor-mediated signaling pathway (IEA,ISO)
Cellular Component
actin cytoskeleton (IEA,ISO) anchoring junction (IEA) axon (IDA) cell cortex (IEA) cell projection (IEA) cell-cell junction (IDA) centrosome (IEA,ISO,ISS) chromatin (IEA,ISO,ISS) costamere (IDA) cytoplasm (IBA,IEA,ISO) cytoskeleton (IEA) cytosol (IEA,ISO) dendritic shaft (IDA) focal adhesion (IBA,IDA,IEA,ISO) lamellipodium (IEA,ISO) membrane (IEA) neuronal cell body (IDA) nucleoplasm (IEA,ISO) nucleus (IEA,ISO,ISS) plasma membrane (IEA) protein-containing complex (IDA) sarcomere (IEA) stress fiber (IDA) terminal bouton (IDA)
Molecular Function
ATP binding (IEA,ISO,ISS) integrin binding (IEA,IPI,ISO) magnesium ion binding (IEA,ISO,ISS) metal ion binding (IEA) nucleotide binding (IEA) protein binding (ISO) protein domain specific binding (IC,IDA) protein kinase activity (IDA,IEA) protein kinase binding (IEA,ISO) protein serine/threonine kinase activity (ISO,ISS) protein-containing complex binding (IDA,IPI) protein-macromolecule adaptor activity (IBA) SH3 domain binding (IDA) signaling receptor binding (IBA)
1.
Integrin-linked kinase expression increases with ovarian tumour grade and is sustained by peritoneal tumour fluid.
Ahmed N, etal., J Pathol. 2003 Oct;201(2):229-37.
2.
Impaired ILK Function Is Associated with Deficits in Hippocampal Based Memory and Synaptic Plasticity in a FASD Rat Model.
Bhattacharya D, etal., PLoS One. 2015 Aug 25;10(8):e0135700. doi: 10.1371/journal.pone.0135700. eCollection 2015.
3.
Role of the integrin-linked kinase/PINCH1/alpha-parvin complex in cardiac myocyte hypertrophy.
Chen H, etal., Lab Invest. 2005 Nov;85(11):1342-56.
4.
Adeno-associated virus-mediated ILK gene silencing in the rat NAc core.
Chen Q, etal., J Neurosci Methods. 2008 Aug 30;173(2):208-14. Epub 2008 Jun 17.
5.
Integrin-linked kinase induces both senescence-associated alterations and extracellular fibronectin assembly in aging cardiac fibroblasts.
Chen X, etal., J Gerontol A Biol Sci Med Sci. 2006 Dec;61(12):1232-45.
6.
Integrin-linked kinase is required for laminin-2-induced oligodendrocyte cell spreading and CNS myelination.
Chun SJ, etal., J Cell Biol. 2003 Oct 27;163(2):397-408.
7.
Phosphorylation of the myosin phosphatase inhibitors, CPI-17 and PHI-1, by integrin-linked kinase.
Deng JT, etal., Biochem J 2002 Oct 15;367(Pt 2):517-24.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
Integrin-linked kinase expression increases with prostate tumor grade.
Graff JR, etal., Clin Cancer Res. 2001 Jul;7(7):1987-91.
11.
Role of the integrin-linked kinase (ILK) in determining neuronal polarity.
Guo W, etal., Dev Biol. 2007 Jun 15;306(2):457-68. Epub 2007 Mar 20.
12.
Regulation of cell adhesion and anchorage-dependent growth by a new beta 1-integrin-linked protein kinase.
Hannigan GE, etal., Nature. 1996 Jan 4;379(6560):91-6. doi: 10.1038/379091a0.
13.
A comprehensive analysis of transcript signatures of the phosphatidylinositol-3 kinase/protein kinase B signal-transduction pathway in prostate cancer.
Hellwinkel OJ, etal., BJU Int. 2008 Jun;101(11):1454-60. Epub 2008 Mar 11.
14.
Integrin-linked kinase in the vascular smooth muscle cell response to injury.
Ho B, etal., Am J Pathol. 2008 Jul;173(1):278-88. Epub 2008 Jun 5.
15.
Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
Jones S, etal., Science. 2008 Sep 26;321(5897):1801-6. Epub 2008 Sep 4.
16.
TGF-beta1 regulates the PINCH-1-integrin-linked kinase-alpha-parvin complex in glomerular cells.
Jung KY, etal., J Am Soc Nephrol. 2007 Jan;18(1):66-73. Epub 2006 Dec 13.
17.
TGF-beta1-induced PINCH-1-ILK-alpha-parvin complex formation regulates mesangial cell proliferation and hypertrophy.
Kim SM, etal., Exp Mol Med. 2007 Aug 31;39(4):514-23.
18.
Cell adhesion-dependent cofilin serine 3 phosphorylation by the integrin-linked kinase.c-Src complex.
Kim YB, etal., J Biol Chem. 2008 Apr 11;283(15):10089-96. Epub 2008 Feb 5.
19.
ILK, PINCH and parvin: the tIPP of integrin signalling.
Legate KR, etal., Nat Rev Mol Cell Biol. 2006 Jan;7(1):20-31.
20.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
21.
Integrin-linked kinase is a positive mediator of L6 myoblast differentiation.
Miller MG, etal., Biochem Biophys Res Commun. 2003 Oct 24;310(3):796-803.
22.
Role of integrin-linked kinase in nerve growth factor-stimulated neurite outgrowth.
Mills J, etal., J Neurosci. 2003 Mar 1;23(5):1638-48.
23.
Rat seminiferous epithelium contains a unique junction (Ectoplasmic specialization) with signaling properties both of cell/cell and cell/matrix junctions.
Mulholland DJ, etal., Biol Reprod. 2001 Jan;64(1):396-407.
24.
An essential role for the integrin-linked kinase-glycogen synthase kinase-3 beta pathway during dendrite initiation and growth.
Naska S, etal., J Neurosci. 2006 Dec 20;26(51):13344-56.
25.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
26.
Integrin-linked kinase (ILK) binding to paxillin LD1 motif regulates ILK localization to focal adhesions.
Nikolopoulos SN and Turner CE, J Biol Chem 2001 Jun 29;276(26):23499-505.
27.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
28.
[Expression of integrin-linked kinase in prostate cancer and its significance]
Qi XP, etal., Zhonghua Nan Ke Xue. 2005 Jan;11(1):34-7.
29.
GOA pipeline
RGD automated data pipeline
30.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
31.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
32.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
33.
Mammary epithelial-specific expression of the integrin-linked kinase (ILK) results in the induction of mammary gland hyperplasias and tumors in transgenic mice.
White DE, etal., Oncogene. 2001 Oct 25;20(48):7064-72.
34.
Involvement of integrin-linked kinase in carbon tetrachloride-induced hepatic fibrosis in rats.
Zhang Y, etal., Hepatology. 2006 Sep;44(3):612-22.
Ilk Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 169,500,716 - 169,506,972 (+) NCBI GRCr8 mRatBN7.2 1 160,088,839 - 160,095,140 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 160,088,897 - 160,095,140 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 168,111,452 - 168,117,707 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 175,297,450 - 175,303,706 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 168,199,208 - 168,205,462 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 170,578,941 - 170,585,192 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 170,578,889 - 170,585,189 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 177,584,793 - 177,591,044 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 163,481,299 - 163,487,550 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 163,576,775 - 163,583,027 (+) NCBI Celera 1 158,020,986 - 158,027,237 (+) NCBI Celera Cytogenetic Map 1 q32 NCBI
ILK Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 6,603,774 - 6,610,870 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 6,603,708 - 6,610,874 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 6,625,004 - 6,632,101 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 6,581,540 - 6,588,677 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 6,581,587 - 6,588,673 NCBI Celera 11 6,744,031 - 6,751,167 (+) NCBI Celera Cytogenetic Map 11 p15.4 NCBI HuRef 11 6,283,875 - 6,291,037 (+) NCBI HuRef CHM1_1 11 6,623,840 - 6,631,006 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 6,662,246 - 6,669,338 (+) NCBI T2T-CHM13v2.0
Ilk Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 105,385,797 - 105,392,132 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 105,385,799 - 105,392,132 (+) Ensembl GRCm39 Ensembl GRCm38 7 105,736,590 - 105,742,925 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 105,736,592 - 105,742,925 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 112,885,104 - 112,891,439 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 105,610,569 - 105,616,743 (+) NCBI MGSCv36 mm8 Celera 7 106,007,890 - 106,014,225 (+) NCBI Celera Cytogenetic Map 7 E3 NCBI cM Map 7 55.97 NCBI
Ilk Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 22,316,047 - 22,322,979 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 22,316,243 - 22,322,979 (+) NCBI ChiLan1.0 ChiLan1.0
ILK Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 9,041,409 - 9,048,059 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 9,005,236 - 9,011,879 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 6,735,735 - 6,742,922 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 6,418,717 - 6,425,788 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 6,418,717 - 6,425,788 (+) Ensembl panpan1.1 panPan2
ILK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 29,911,326 - 29,917,972 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 29,911,364 - 29,917,974 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 29,613,150 - 29,619,814 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 30,737,472 - 30,744,133 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 30,737,533 - 30,744,128 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 30,058,249 - 30,064,907 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 30,223,907 - 30,230,574 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 30,419,226 - 30,425,893 (+) NCBI UU_Cfam_GSD_1.0
Ilk
ILK Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 3,145,608 - 3,159,858 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 3,145,647 - 3,152,097 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 3,803,434 - 3,810,297 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ILK Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 58,214,630 - 58,221,770 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 58,213,310 - 58,221,217 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 156,040,403 - 156,047,520 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ilk
.
Predicted Target Of
Count of predictions: 50 Count of miRNA genes: 42 Interacting mature miRNAs: 47 Transcripts: ENSRNOT00000025906 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 631206 Niddm40 Non-insulin dependent diabetes mellitus QTL 40 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 136745990 163747690 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634315 Niddm45 Non-insulin dependent diabetes mellitus QTL 45 7.16 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 144267916 172949660 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 61379 Bp44 Blood pressure QTL 44 19.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144267916 174133260 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1582204 Livw1 Liver weight QTL 1 3.6 0.0003 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 1 155422851 172949803 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8693608 Alc24 Alcohol consumption QTL 24 2.3 0.74 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 150452391 168228760 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 631548 Bp88 Blood pressure QTL 88 5 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 156677124 176484451 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
Ilk
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 160,093,405 - 160,095,075 (+) MAPPER mRatBN7.2 Rnor_6.0 1 170,583,458 - 170,585,127 NCBI Rnor6.0 Rnor_5.0 1 177,589,310 - 177,590,979 UniSTS Rnor5.0 RGSC_v3.4 1 163,485,816 - 163,487,485 UniSTS RGSC3.4 Celera 1 158,025,503 - 158,027,172 UniSTS Cytogenetic Map 1 q33 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025906 ⟹ ENSRNOP00000025906
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 160,088,897 - 160,095,135 (+) Ensembl Rnor_6.0 Ensembl 1 170,578,889 - 170,585,189 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000100840 ⟹ ENSRNOP00000090879
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 160,091,430 - 160,095,140 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108565 ⟹ ENSRNOP00000090768
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 160,088,911 - 160,094,876 (+) Ensembl
RefSeq Acc Id:
NM_133409 ⟹ NP_596900
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 169,500,721 - 169,506,972 (+) NCBI mRatBN7.2 1 160,088,888 - 160,095,140 (+) NCBI Rnor_6.0 1 170,578,941 - 170,585,192 (+) NCBI Rnor_5.0 1 177,584,793 - 177,591,044 (+) NCBI RGSC_v3.4 1 163,481,299 - 163,487,550 (+) RGD Celera 1 158,020,986 - 158,027,237 (+) RGD
Sequence:
GCGACCCGAGTCCCGTTCCCCGAGACTTCCCCAGTCCCGGGGTCTCTGTGCCGGGACGCTGCTATGGACGACATTTTCACTCAGTGCCGGGAGGGCAACGCGGTGGCGGTGCGCTTGTGGCTGGACAA
hide sequence
RefSeq Acc Id:
XM_039085303 ⟹ XP_038941231
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 169,500,716 - 169,506,968 (+) NCBI mRatBN7.2 1 160,088,839 - 160,095,132 (+) NCBI
RefSeq Acc Id:
NP_596900 ⟸ NM_133409
- UniProtKB:
Q99J82 (UniProtKB/Swiss-Prot), A6I7L9 (UniProtKB/TrEMBL), A0A8I6AP40 (UniProtKB/TrEMBL)
- Sequence:
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSI
hide sequence
Ensembl Acc Id:
ENSRNOP00000025906 ⟸ ENSRNOT00000025906
RefSeq Acc Id:
XP_038941231 ⟸ XM_039085303
- Peptide Label:
isoform X1
- UniProtKB:
Q99J82 (UniProtKB/Swiss-Prot), A6I7L9 (UniProtKB/TrEMBL), A0A8I6AP40 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000090879 ⟸ ENSRNOT00000100840
Ensembl Acc Id:
ENSRNOP00000090768 ⟸ ENSRNOT00000108565
RGD ID: 13690291 Promoter ID: EPDNEW_R816 Type: initiation region Name: Ilk_1 Description: integrin-linked kinase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 170,578,932 - 170,578,992 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2010-02-09
Ilk
integrin-linked kinase
Ilk
integrin linked kinase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Ilk
integrin linked kinase
integrin-linked kinase
Name updated
1299863 APPROVED
2002-08-07
Ilk
integrin-linked kinase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
localized to focal adhesions with paxillin
633110
gene_function
phosphorylates both CPI-17 (protein kinase C (PKC)-dependent phosphatase inhibitor of 17 kDa) and PHI-1 (phosphatase holoenzyme inhibitor-1)
633111
gene_physical_interaction
interacts with Paxillin
633110
