Symbol:
Oxt
Name:
oxytocin/neurophysin I prepropeptide
RGD ID:
3238
Description:
Enables neuropeptide hormone activity and oxytocin receptor binding activity. Involved in several processes, including positive regulation of secretion by cell; positive regulation of smooth muscle contraction; and regulation of blood pressure. Located in extracellular space; secretory granule; and terminal bouton. Is active in neuronal dense core vesicle. Used to study gastric ulcer and hypertension. Biomarker of amphetamine abuse and hypertension. Orthologous to human OXT (oxytocin/neurophysin I prepropeptide); PARTICIPATES IN oxytocin signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,4-D.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
OT-NPI; oxcytocin; oxytocin; oxytocin, prepropeptide; oxytocin-neurophysin 1; Oxytocin/neurophysin; oxytocin/neurophysin (Oxt) gene, complete gene, complete cds; oxytocin/neurophysin 1 prepropeptide; Rat oxytocin/neurophysin (Oxt) gene complete gene complete cds
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
OXT (oxytocin/neurophysin I prepropeptide) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Oxt (oxytocin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
OXT (oxytocin/neurophysin I prepropeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
OXT (oxytocin/neurophysin I prepropeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
OXT (oxytocin/neurophysin I prepropeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
OXT (oxytocin/neurophysin I prepropeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Oxt (oxytocin/neurophysin I prepropeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
AVP (arginine vasopressin) HGNC
OrthoDB
Homo sapiens (human):
YTHDC2 (YTH N6-methyladenosine RNA binding protein C2) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Oxt (oxytocin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
OXT (oxytocin/neurophysin I prepropeptide)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
oxt (oxytocin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
ntc-1
Alliance
DIOPT (PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
oxt
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Candidate Gene For:
Bp37
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 138,235,754 - 138,236,594 (+) NCBI GRCr8 mRatBN7.2 3 117,782,650 - 117,783,490 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 117,782,650 - 117,783,490 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 121,677,109 - 121,677,940 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 130,274,375 - 130,275,205 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 127,933,240 - 127,934,071 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 123,106,694 - 123,107,534 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 123,106,694 - 123,107,534 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 129,604,822 - 129,605,662 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 118,194,219 - 118,195,056 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 118,097,303 - 118,100,512 (+) NCBI Celera 3 116,593,509 - 116,594,349 (+) NCBI Celera Cytogenetic Map 3 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Oxt Rat 1,2-dimethylhydrazine decreases expression ISO RGD:11040 6480464 1,2-Dimethylhydrazine results in decreased expression of OXT mRNA CTD PMID:22206623 Oxt Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of OXT mRNA CTD PMID:15834898|PMID:17351261 Oxt Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of OXT mRNA CTD PMID:27571134 Oxt Rat 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with OXT protein] results in increased expression of SLC5A5 mRNA; [Estradiol co-treated with more ... CTD PMID:16954431|PMID:17400809|PMID:22265196|PMID:26945725 Oxt Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of OXT mRNA CTD PMID:17010207|PMID:17400809|PMID:23664861|PMID:26945725 Oxt Rat 17beta-estradiol multiple interactions ISO RGD:11040 6480464 [Estradiol co-treated with Progesterone] results in increased expression of OXT mRNA; ESR2 affects the reaction more ... CTD PMID:12834440 Oxt Rat 2,4-D decreases secretion EXP 6480464 2,4-Dichlorophenoxyacetic Acid results in decreased secretion of OXT protein CTD PMID:20122984 Oxt Rat 3,5,6-trichloro-2-pyridinol multiple interactions ISO RGD:11040 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate co-treated more ... CTD PMID:32518293 Oxt Rat 3,5,6-trichloropyridine-2-one multiple interactions ISO RGD:11040 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate co-treated more ... CTD PMID:32518293 Oxt Rat 3-phenoxybenzoic acid multiple interactions ISO RGD:11040 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate co-treated more ... CTD PMID:32518293 Oxt Rat 4-tert-Octylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of OXT mRNA CTD PMID:23664861 Oxt Rat 5'-phosphopyridoxal-6-azobenzene-2,4-disulfonic acid multiple interactions EXP 6480464 pyridoxal phosphate-6-azophenyl-2',4'-disulfonic acid inhibits the reaction [[Phenylephrine co-treated with Adenosine Triphosphate] results in increased secretion more ... CTD PMID:11102496 Oxt Rat 8-OH-DPAT multiple interactions EXP 6480464 [8-Hydroxy-2-(di-n-propylamino)tetralin binds to and results in decreased activity of HTR1A protein] which results in increased more ... CTD PMID:22265196 Oxt Rat AM-251 multiple interactions EXP 6480464 AM 251 promotes the reaction [[Water deficiency co-treated with Sodium Chloride, Dietary deficiency] results in more ... CTD PMID:26468265 Oxt Rat AM-251 increases secretion EXP 6480464 AM 251 results in increased secretion of OXT protein CTD PMID:26468265 Oxt Rat AM-251 increases expression EXP 6480464 AM 251 results in increased expression of OXT mRNA CTD PMID:26468265 Oxt Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of OXT mRNA CTD PMID:16483693 Oxt Rat arachidonyl-2'-chloroethylamide multiple interactions EXP 6480464 arachidonyl-2-chloroethylamide inhibits the reaction [[Water deficiency co-treated with Sodium Chloride, Dietary deficiency] results in increased more ... CTD PMID:26468265 Oxt Rat ATP multiple interactions EXP 6480464 Adenosine Triphosphate promotes the reaction [Phenylephrine results in increased secretion of OXT protein]; pyridoxal phosphate-6-azophenyl-2',4'-disulfonic more ... CTD PMID:11102496 Oxt Rat ATP increases secretion EXP 6480464 Adenosine Triphosphate results in increased secretion of OXT protein CTD PMID:11102496 Oxt Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of OXT mRNA CTD PMID:21839799 Oxt Rat benzo[a]pyrene affects methylation ISO RGD:737586 6480464 Benzo(a)pyrene affects the methylation of OXT promoter CTD PMID:27901495 Oxt Rat benzo[a]pyrene decreases methylation ISO RGD:737586 6480464 Benzo(a)pyrene results in decreased methylation of OXT exon CTD PMID:27901495 Oxt Rat benzo[a]pyrene decreases expression ISO RGD:11040 6480464 Benzo(a)pyrene results in decreased expression of OXT mRNA CTD PMID:22228805 Oxt Rat bisphenol A decreases expression ISO RGD:11040 6480464 bisphenol A results in decreased expression of OXT mRNA CTD PMID:22707478 Oxt Rat bisphenol A multiple interactions ISO RGD:11040 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate co-treated more ... CTD PMID:32518293 Oxt Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of OXT mRNA CTD PMID:27571134 Oxt Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of OXT mRNA CTD PMID:25181051 Oxt Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of OXT mRNA CTD PMID:17010207|PMID:23664861 Oxt Rat Butylbenzyl phthalate multiple interactions ISO RGD:11040 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate co-treated more ... CTD PMID:32518293 Oxt Rat Butylparaben multiple interactions EXP 6480464 [Plasticizers co-treated with Fungicides, Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated more ... CTD PMID:34383603 Oxt Rat butyric acid increases expression ISO RGD:11040 6480464 Butyric Acid results in increased expression of OXT mRNA CTD PMID:22687346 Oxt Rat calcium atom multiple interactions ISO RGD:737586 6480464 OXT protein promotes the reaction [TRPC3 protein results in increased transport of Calcium] CTD PMID:12700192 Oxt Rat calcium atom multiple interactions EXP 6480464 [Thapsigargin results in increased transport of Calcium] which results in increased secretion of OXT protein CTD PMID:22028774 Oxt Rat calcium(0) multiple interactions ISO RGD:737586 6480464 OXT protein promotes the reaction [TRPC3 protein results in increased transport of Calcium] CTD PMID:12700192 Oxt Rat calcium(0) multiple interactions EXP 6480464 [Thapsigargin results in increased transport of Calcium] which results in increased secretion of OXT protein CTD PMID:22028774 Oxt Rat chlorpyrifos increases expression ISO RGD:11040 6480464 Chlorpyrifos results in increased expression of OXT protein CTD PMID:19165396 Oxt Rat chlorpyrifos decreases expression ISO RGD:11040 6480464 Chlorpyrifos results in decreased expression of OXT mRNA CTD PMID:25889763 Oxt Rat clofibrate multiple interactions ISO RGD:11040 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of OXT mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Oxt Rat clozapine affects response to substance ISO RGD:737586 6480464 OXT protein affects the susceptibility to Clozapine CTD PMID:20196918 Oxt Rat colforsin daropate hydrochloride multiple interactions ISO RGD:737586 6480464 BMP6 protein inhibits the reaction [Colforsin results in increased expression of OXT mRNA] CTD PMID:18936084 Oxt Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of OXT mRNA CTD PMID:30556269 Oxt Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of OXT mRNA CTD PMID:30556269 Oxt Rat cortisol affects abundance ISO RGD:737586 6480464 OXT protein affects the abundance of Hydrocortisone CTD PMID:16554389 Oxt Rat DDE multiple interactions ISO RGD:11040 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate co-treated more ... CTD PMID:32518293 Oxt Rat DDE multiple interactions EXP 6480464 [Plasticizers co-treated with Fungicides, Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated more ... CTD PMID:34383603 Oxt Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of OXT mRNA CTD PMID:23914054 Oxt Rat dibutyl phthalate multiple interactions ISO RGD:11040 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate co-treated more ... CTD PMID:32518293 Oxt Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of OXT mRNA CTD PMID:33920546 Oxt Rat diethyl phthalate multiple interactions ISO RGD:11040 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate co-treated more ... CTD PMID:32518293 Oxt Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of OXT mRNA CTD PMID:17010207|PMID:37077353 Oxt Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of OXT mRNA CTD PMID:33920546 Oxt Rat Diisodecyl phthalate multiple interactions ISO RGD:11040 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate co-treated more ... CTD PMID:32518293 Oxt Rat diprotium oxide multiple interactions EXP 6480464 [Water deficiency co-treated with Sodium Chloride, Dietary deficiency] results in increased expression of OXT mRNA; more ... CTD PMID:26468265 Oxt Rat enzacamene multiple interactions EXP 6480464 [Plasticizers co-treated with Fungicides, Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated more ... CTD PMID:34383603 Oxt Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of OXT mRNA CTD PMID:18035473 Oxt Rat fluoxetine decreases expression EXP 6480464 Fluoxetine results in decreased expression of OXT mRNA CTD PMID:17033635 Oxt Rat folic acid decreases expression ISO RGD:11040 6480464 Folic Acid results in decreased expression of OXT mRNA CTD PMID:25629700 Oxt Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of OXT mRNA CTD PMID:37077353 Oxt Rat linuron multiple interactions EXP 6480464 [Plasticizers co-treated with Fungicides, Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated more ... CTD PMID:34383603 Oxt Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of OXT mRNA CTD PMID:11739594 Oxt Rat lithium atom increases secretion EXP 6480464 Lithium results in increased secretion of OXT protein CTD PMID:11739594 Oxt Rat lithium hydride increases secretion EXP 6480464 Lithium results in increased secretion of OXT protein CTD PMID:11739594 Oxt Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of OXT mRNA CTD PMID:11739594 Oxt Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] affects the expression of OXT mRNA CTD PMID:19564919 Oxt Rat methamphetamine affects expression EXP 6480464 Methamphetamine affects the expression of OXT mRNA CTD PMID:19564919 Oxt Rat Nonylphenol increases expression EXP 6480464 nonylphenol results in increased expression of OXT mRNA CTD PMID:17010207 Oxt Rat p-tert-Amylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of OXT mRNA CTD PMID:23664861 Oxt Rat paclitaxel increases expression EXP 6480464 Paclitaxel analog results in increased expression of OXT mRNA; Paclitaxel results in increased expression of more ... CTD PMID:15585946 Oxt Rat paracetamol multiple interactions ISO RGD:11040 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of OXT mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Oxt Rat paracetamol multiple interactions EXP 6480464 [Plasticizers co-treated with Fungicides, Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated more ... CTD PMID:34383603 Oxt Rat phenylephrine multiple interactions EXP 6480464 Adenosine Triphosphate promotes the reaction [Phenylephrine results in increased secretion of OXT protein]; pyridoxal phosphate-6-azophenyl-2',4'-disulfonic more ... CTD PMID:11102496 Oxt Rat phenylephrine increases secretion EXP 6480464 Phenylephrine results in increased secretion of OXT protein CTD PMID:15149956 Oxt Rat prazosin increases expression EXP 6480464 Prazosin results in increased expression of OXT protein CTD PMID:1791990 Oxt Rat progesterone multiple interactions EXP 6480464 Progesterone inhibits the reaction [Estradiol results in increased expression of OXT mRNA] CTD PMID:17400809 Oxt Rat progesterone multiple interactions ISO RGD:11040 6480464 [Estradiol co-treated with Progesterone] results in increased expression of OXT mRNA; ESR2 affects the reaction more ... CTD PMID:12834440 Oxt Rat pyridaben decreases expression ISO RGD:11040 6480464 pyridaben results in decreased expression of OXT mRNA CTD PMID:22563483 Oxt Rat resveratrol multiple interactions ISO RGD:737586 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of OXT mRNA CTD PMID:23557933 Oxt Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] affects the expression of OXT mRNA CTD PMID:19564919 Oxt Rat SCH 23390 affects expression EXP 6480464 SCH 23390 affects the expression of OXT mRNA CTD PMID:19564919 Oxt Rat serotonin increases secretion ISO RGD:11040 6480464 OXT protein results in increased secretion of Serotonin CTD PMID:19228979 Oxt Rat sodium arsenite increases expression ISO RGD:11040 6480464 sodium arsenite results in increased expression of OXT mRNA CTD PMID:37682722 Oxt Rat thapsigargin multiple interactions EXP 6480464 [Thapsigargin results in increased transport of Calcium] which results in increased secretion of OXT protein CTD PMID:22028774 Oxt Rat titanium dioxide decreases methylation ISO RGD:11040 6480464 titanium dioxide results in decreased methylation of OXT gene CTD PMID:35295148 Oxt Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of OXT mRNA CTD PMID:33387578 Oxt Rat triptonide increases expression ISO RGD:11040 6480464 triptonide results in increased expression of OXT mRNA CTD PMID:33045310 Oxt Rat valproic acid affects expression ISO RGD:11040 6480464 Valproic Acid affects the expression of OXT mRNA CTD PMID:17292431 Oxt Rat valproic acid increases expression ISO RGD:737586 6480464 Valproic Acid results in increased expression of OXT mRNA CTD PMID:29154799 Oxt Rat water multiple interactions EXP 6480464 [Water deficiency co-treated with Sodium Chloride, Dietary deficiency] results in increased expression of OXT mRNA; more ... CTD PMID:26468265
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,4-D (EXP) 3,5,6-trichloro-2-pyridinol (ISO) 3,5,6-trichloropyridine-2-one (ISO) 3-phenoxybenzoic acid (ISO) 4-tert-Octylphenol (EXP) 5'-phosphopyridoxal-6-azobenzene-2,4-disulfonic acid (EXP) 8-OH-DPAT (EXP) AM-251 (EXP) ammonium chloride (EXP) arachidonyl-2'-chloroethylamide (EXP) ATP (EXP) benzo[a]pyrene (EXP,ISO) bisphenol A (EXP,ISO) Butylbenzyl phthalate (ISO) Butylparaben (EXP) butyric acid (ISO) calcium atom (EXP,ISO) calcium(0) (EXP,ISO) chlorpyrifos (ISO) clofibrate (ISO) clozapine (ISO) colforsin daropate hydrochloride (ISO) copper atom (EXP) copper(0) (EXP) cortisol (ISO) DDE (EXP,ISO) decabromodiphenyl ether (EXP) dibutyl phthalate (EXP,ISO) diethyl phthalate (ISO) diethylstilbestrol (EXP) Diisodecyl phthalate (ISO) diprotium oxide (EXP) enzacamene (EXP) flavonoids (EXP) fluoxetine (EXP) folic acid (ISO) ketoconazole (EXP) linuron (EXP) lithium atom (EXP) lithium hydride (EXP) methamphetamine (EXP) Nonylphenol (EXP) p-tert-Amylphenol (EXP) paclitaxel (EXP) paracetamol (EXP,ISO) phenylephrine (EXP) prazosin (EXP) progesterone (EXP,ISO) pyridaben (ISO) resveratrol (ISO) SCH 23390 (EXP) serotonin (ISO) sodium arsenite (ISO) thapsigargin (EXP) titanium dioxide (ISO) trichloroethene (EXP) triptonide (ISO) valproic acid (ISO) water (EXP)
1.
Relationship between gene expression and function of uterotonic systems in the rat during gestation, uterine activation and both term and preterm labour.
Arthur P, etal., J Physiol. 2008 Dec 15;586(Pt 24):6063-76. Epub 2008 Oct 20.
2.
Gastric antisecretory and antiulcer activity of oxytocin in rats and guinea pigs.
Asad M, etal., Life Sci. 2001 Nov 21;70(1):17-24.
3.
Phenylethanolamine N-methyltransferase gene expression in the heart and blood pressure response to oxytocin treatment in rats exposed to voluntary wheel running.
Bakos J, etal., Ann N Y Acad Sci. 2008 Dec;1148:302-7.
4.
CNS region-specific oxytocin receptor expression: importance in regulation of anxiety and sex behavior.
Bale TL, etal., J Neurosci. 2001 Apr 1;21(7):2546-52.
5.
Oxytocin, water intake, and food sodium availability in male rats.
Bernal A, etal., Horm Behav. 2007 Sep;52(3):289-96. Epub 2007 May 22.
6.
Vasopressin and oxytocin release as influenced by thyrotropin-releasing hormone in euhydrated and dehydrated rats.
Ciosek J J Physiol Pharmacol 2002 Sep;53(3):423-37.
7.
Time course of c-fos, vasopressin and oxytocin mRNA expression in the hypothalamus following long-term dehydration.
da Silveira LT, etal., Cell Mol Neurobiol. 2007 Aug;27(5):575-84.
8.
Oxytocin alleviates hepatic ischemia-reperfusion injury in rats.
Dusunceli F, etal., Peptides. 2008 Jul;29(7):1216-22. Epub 2008 Feb 26.
9.
Chromosomal and comparative mapping of rat oxytocin, oxytocin receptor and vasopressin genes.
Dutil J, etal., Cytogenet Cell Genet 2001;93(1-2):57-9.
10.
Possible neuroendocrine role for oxytocin in bone remodeling.
Elabd SK, etal., Endocr Regul. 2007 Nov;41(4):131-41.
11.
Estradiol Upregulates the Expression of Oxytocin Receptor in Colon in Rats.
Feng M, etal., Am J Physiol Endocrinol Metab. 2009 Mar 3.
12.
Oxytocin receptor activity in the ventrocaudal periaqueductal gray modulates anxiety-related behavior in postpartum rats.
Figueira RJ, etal., Behav Neurosci. 2008 Jun;122(3):618-28.
13.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
14.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
15.
Oxytocin-induced contractions within rat and rabbit ejaculatory tissues are mediated by vasopressin V(1A) receptors and not oxytocin receptors.
Gupta J, etal., Br J Pharmacol. 2008 Sep;155(1):118-26. Epub 2008 Jun 16.
16.
Microarray analysis of the transcriptome of the subfornical organ in the rat: regulation by fluid and food deprivation.
Hindmarch C, etal., Am J Physiol Regul Integr Comp Physiol. 2008 Dec;295(6):R1914-20. Epub 2008 Oct 1.
17.
The proximal portion of the COOH terminus of the oxytocin receptor is required for coupling to g(q), but not g(i). Independent mechanisms for elevating intracellular calcium concentrations from intracellular stores.
Hoare S, etal., J Biol Chem. 1999 Oct 1;274(40):28682-9.
18.
Science review: Vasopressin and the cardiovascular system part 1--receptor physiology.
Holmes CL, etal., Crit Care. 2003 Dec;7(6):427-34. Epub 2003 Jun 26.
19.
Vasopressin and oxytocin excite distinct neuronal populations in the central amygdala.
Huber D, etal., Science. 2005 Apr 8;308(5719):245-8.
20.
Oxytocin ameliorates skin damage and oxidant gastric injury in rats with thermal trauma.
Iseri SO, etal., Burns. 2008 May;34(3):361-9. Epub 2007 Sep 10.
21.
Structure and comparison of the oxytocin and vasopressin genes from rat.
Ivell R and Richter D, Proc Natl Acad Sci U S A 1984 Apr;81(7):2006-10.
22.
Oxytocin in cardiac ontogeny.
Jankowski M, etal., Proc Natl Acad Sci U S A. 2004 Aug 31;101(35):13074-9. Epub 2004 Aug 17.
23.
Co-expression of vasopressin and androgen-binding protein in the rat hypothalamus.
Jirikowski GF, etal., J Chem Neuroanat. 2005 Jun;29(4):233-7. Epub 2005 Mar 17.
24.
Oxytocin release from the rat neurohypophysis into the blood: effects of tachykinin NK-1 and NK-2 receptors agonists and antagonists.
Juszczak M and Boczek-Leszczyk E, J Physiol Pharmacol. 2008 Sep;59(3):553-62.
25.
Impaired thermoregulatory ability of oxytocin-deficient mice during cold-exposure.
Kasahara Y, etal., Biosci Biotechnol Biochem. 2007 Dec;71(12):3122-6. doi: 10.1271/bbb.70498. Epub 2007 Dec 7.
26.
Compulsive methamphetamine taking in the presence of punishment is associated with increased oxytocin expression in the nucleus accumbens of rats.
Krasnova IN, etal., Sci Rep. 2017 Aug 21;7(1):8331. doi: 10.1038/s41598-017-08898-8.
27.
Differential effect of neocuproine, a copper(I) chelator, on contractile activity in isolated ovariectomized non-pregnant rat, pregnant rat and pregnant human uterus.
Kumcu EK, etal., Eur J Pharmacol. 2009 Mar 1;605(1-3):158-63.
28.
Intracerebral oxytocin modulates sleep-wake behaviour in male rats.
Lancel M, etal., Regul Pept. 2003 Jul 15;114(2-3):145-52.
29.
Vaginocervical stimulation enhances social recognition memory in rats via oxytocin release in the olfactory bulb.
Larrazolo-Lopez A, etal., Neuroscience. 2008 Mar 27;152(3):585-93. Epub 2008 Jan 25.
30.
Effect of alcohol use disorder on oxytocin peptide and receptor mRNA expression in human brain: A post-mortem case-control study.
Lee MR, etal., Psychoneuroendocrinology. 2017 Nov;85:14-19. doi: 10.1016/j.psyneuen.2017.07.481. Epub 2017 Jul 15.
31.
Prenatal stress generates deficits in rat social behavior: Reversal by oxytocin.
Lee PR, etal., Brain Res. 2007 Jul 2;1156:152-67. Epub 2007 Apr 22.
32.
Molecular mechanisms of antidiuretic effect of oxytocin.
Li C, etal., J Am Soc Nephrol. 2008 Feb;19(2):225-32. Epub 2007 Dec 5.
33.
Intracellular calcium stores regulate activity-dependent neuropeptide release from dendrites.
Ludwig M, etal., Nature 2002 Jul 4;418(6893):85-9.
34.
Maternal separation interferes with developmental changes in brain vasopressin and oxytocin receptor binding in male rats.
Lukas M, etal., Neuropharmacology. 2009 Jun 26.
35.
Oxytocin Pretreatment Decreases Oxytocin-induced Myometrial Contractions in Pregnant Rats in a Concentration-dependent But Not Time-dependent Manner.
Magalhaes J, etal., Reprod Sci. 2009 Jan 22.
36.
Neuroanatomical and cellular substrates of hypergrooming induced by microinjection of oxytocin in central nucleus of amygdala, an experimental model of compulsive behavior.
Marroni SS, etal., Mol Psychiatry. 2007 Dec;12(12):1103-17. Epub 2007 May 15.
37.
PVN electrical stimulation prolongs withdrawal latencies and releases oxytocin in cerebrospinal fluid, plasma, and spinal cord tissue in intact and neuropathic rats.
Martinez-Lorenzana G, etal., Pain. 2008 Nov 30;140(2):265-73. Epub 2008 Sep 26.
38.
Hypertension and exercise training differentially affect oxytocin and oxytocin receptor expression in the brain.
Martins AS, etal., Hypertension. 2005 Oct;46(4):1004-9. Epub 2005 Sep 12.
39.
Intergenerational effects of cocaine on maternal aggressive behavior and brain oxytocin in rat dams.
McMurray MS, etal., Stress. 2008;11(5):398-410.
40.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
41.
Intrauterine oxytocin system. Compartmental distribution of oxytocin and oxytocin receptors in rat endometrial epithelium.
Morel G, etal., Cell Tissue Res. 2001 Jun;304(3):377-82.
42.
Augmentation of morphine-conditioned place preference by food restriction is associated with alterations in the oxytocin/oxytocin receptor in rat models.
Mousavi A, etal., Am J Drug Alcohol Abuse. 2020 May 3;46(3):304-315. doi: 10.1080/00952990.2019.1648483. Epub 2019 Oct 14.
43.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
44.
Interaction between oestrogen and oxytocin on hypothalamic-pituitary-adrenal axis activity.
Ochedalski T, etal., J Neuroendocrinol. 2007 Mar;19(3):189-97.
45.
Complexity of neural mechanisms underlying overconsumption of sugar in scheduled feeding: Involvement of opioids, orexin, oxytocin and NPY.
Olszewski PK, etal., Peptides. 2009 Feb;30(2):226-33. Epub 2008 Oct 30.
46.
Facilitative role of endogenous oxytocin in noradrenaline release in the rat supraoptic nucleus.
Onaka T, etal., Eur J Neurosci. 2003 Dec;18(11):3018-26.
47.
Oxytocin exerts protective effects on in vitro myocardial injury induced by ischemia and reperfusion.
Ondrejcakova M, etal., Can J Physiol Pharmacol. 2009 Feb;87(2):137-42.
48.
Oxytocin enhances cranial visceral afferent synaptic transmission to the solitary tract nucleus.
Peters JH, etal., J Neurosci. 2008 Nov 5;28(45):11731-40.
49.
Postnatal oxytocin treatment of spontaneously hypertensive male rats decreases blood pressure and body weight in adulthood.
Petersson M and Uvnas-Moberg K, Neurosci Lett. 2008 Aug 1;440(2):166-9. Epub 2008 Jun 16.
50.
Neonatal oxytocin treatment modulates oxytocin receptor, atrial natriuretic peptide, nitric oxide synthase and estrogen receptor mRNAs expression in rat heart.
Pournajafi-Nazarloo H, etal., Peptides. 2007 Jun;28(6):1170-7. Epub 2007 May 6.
51.
The neurohypophyseal hormones vasopressin and oxytocin. Precursor structure, synthesis and regulation.
Rehbein M, etal., Biol Chem Hoppe Seyler 1986 Aug;367(8):695-704.
52.
GOA pipeline
RGD automated data pipeline
53.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
54.
Glucocorticoid modulation of neuronal activity and hormone secretion induced by blood volume expansion.
Ruginsk SG, etal., Exp Neurol. 2007 Aug;206(2):192-200. Epub 2007 May 10.
55.
Involvement of neuromedin S in the oxytocin release response to suckling stimulus.
Sakamoto T, etal., Biochem Biophys Res Commun. 2008 Oct 10;375(1):49-53. Epub 2008 Aug 12.
56.
Rat vasopressin and oxytocin genes are linked by a long interspersed repeated DNA element (LINE): sequence and transcriptional analysis of LINE.
Schmitz E, etal., DNA Cell Biol 1991 Mar;10(2):81-91.
57.
cAMP stimulation of vasopressin and oxytocin release and regulation of vasopressin mRNA stability: role of auto-facilitation.
Song Z, etal., J Neuroendocrinol. 2001 Feb;13(2):158-65.
58.
ERK2 mediates oxytocin-stimulated PGE2 synthesis.
Strakova Z, etal., Am J Physiol. 1998 Apr;274(4 Pt 1):E634-41.
59.
Oxytocin induces penile erection when injected into the ventral tegmental area of male rats: role of nitric oxide and cyclic GMP.
Succu S, etal., Eur J Neurosci. 2008 Aug;28(4):813-21. Epub 2008 Jul 30.
60.
The effects of alprostadil on hypothalamic and amygdalar function and the central expression of oxytocin: a potential central role of alprostadil cream.
Sun X, etal., J Sex Med. 2009 Jan;6(1):81-90. Epub 2008 Nov 5.
61.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
62.
Oxytocin and estrogen promote rapid formation of functional GABA synapses in the adult supraoptic nucleus.
Theodosis DT, etal., Mol Cell Neurosci. 2006 Apr;31(4):785-94. Epub 2006 Feb 20.
63.
Oxytocin-immunoreactive terminals synapse on oxytocin neurones in the supraoptic nucleus.
Theodosis DT, Nature. 1985 Feb 21-27;313(6004):682-4. doi: 10.1038/313682a0.
64.
A role for oxytocin and 5-HT(1A) receptors in the prosocial effects of 3,4 methylenedioxymethamphetamine ("ecstasy").
Thompson MR, etal., Neuroscience. 2007 May 11;146(2):509-14. Epub 2007 Mar 23.
65.
Central vasopressin and oxytocin release: regulation of complex social behaviours.
Veenema AH and Neumann ID, Prog Brain Res. 2008;170:261-76.
66.
Evidence for an interaction between CB1 cannabinoid and oxytocin receptors in food and water intake.
Verty AN, etal., Neuropharmacology. 2004 Sep;47(4):593-603.
67.
Genistein supplementation stimulates the oxytocin system in the aorta of ovariectomized rats.
Wang D, etal., Cardiovasc Res. 2003 Jan;57(1):186-94.
68.
Dominant role of betagamma subunits of G-proteins in oxytocin-evoked burst firing.
Wang YF and Hatton GI, J Neurosci. 2007 Feb 21;27(8):1902-12.
69.
Neurosteroid regulation of oxytocin and vasopressin release from the rat supraoptic nucleus.
Widmer H, etal., J Physiol. 2003 Apr 1;548(Pt 1):233-44. Epub 2003 Feb 14.
70.
Pharmacological effects of oxytocin on gastric emptying and intestinal transit of a non-nutritive liquid meal in female rats.
Wu CL, etal., Naunyn Schmiedebergs Arch Pharmacol. 2003 Apr;367(4):406-13. Epub 2003 Feb 26.
71.
Effect of oxytocin on acupuncture analgesia in the rat.
Yang J, etal., Neuropeptides. 2007 Oct;41(5):285-92. Epub 2007 Jul 30.
72.
Oxytocin administered intrathecally preferentially increases heart rate rather than arterial pressure in the rat.
Yashpal K, etal., J Auton Nerv Syst. 1987 Aug;20(2):167-78.
73.
Differential kinetics of oxytocin and vasopressin heteronuclear RNA expression in the rat supraoptic nucleus in response to chronic salt loading in vivo.
Yue C, etal., J Neuroendocrinol. 2008 Feb;20(2):227-32. Epub 2007 Dec 14.
74.
Vasopressin administration into the PVN normalizes plasma oxytocin and corticosterone levels in Brattleboro rats.
Zelena D, etal., Endocrinology. 2009 Feb 26.
75.
Impact of ether anesthesia on the hypophyseal content of oxytocin neurophysin I and II: a comparative study with ketamine in the rat.
Zierer R Life Sci. 1991;49(19):1391-7.
Oxt Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 138,235,754 - 138,236,594 (+) NCBI GRCr8 mRatBN7.2 3 117,782,650 - 117,783,490 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 117,782,650 - 117,783,490 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 121,677,109 - 121,677,940 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 130,274,375 - 130,275,205 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 127,933,240 - 127,934,071 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 123,106,694 - 123,107,534 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 123,106,694 - 123,107,534 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 129,604,822 - 129,605,662 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 118,194,219 - 118,195,056 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 118,097,303 - 118,100,512 (+) NCBI Celera 3 116,593,509 - 116,594,349 (+) NCBI Celera Cytogenetic Map 3 q36 NCBI
OXT Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 3,071,620 - 3,072,517 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 3,071,620 - 3,072,517 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 3,052,266 - 3,053,163 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 3,000,266 - 3,001,162 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 3,000,265 - 3,001,162 NCBI Celera 20 3,114,251 - 3,115,147 (+) NCBI Celera Cytogenetic Map 20 p13 NCBI HuRef 20 2,998,607 - 2,999,505 (+) NCBI HuRef CHM1_1 20 3,046,806 - 3,047,704 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 3,099,764 - 3,103,415 (+) NCBI T2T-CHM13v2.0
Oxt Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 130,416,432 - 130,418,974 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 130,418,093 - 130,418,974 (+) Ensembl GRCm39 Ensembl GRCm38 2 130,574,519 - 130,577,054 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 130,576,173 - 130,577,054 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 130,401,909 - 130,402,724 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 130,267,614 - 130,268,429 (+) NCBI MGSCv36 mm8 Celera 2 131,800,597 - 131,801,412 (+) NCBI Celera Cytogenetic Map 2 F1 NCBI cM Map 2 63.24 NCBI
OXT Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 4,039,169 - 4,040,042 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 4,034,732 - 4,036,865 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 3,157,246 - 3,159,013 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3
OXT Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 18,193,381 - 18,194,232 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 18,193,339 - 18,194,170 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 18,021,790 - 18,022,393 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 18,612,328 - 18,612,968 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 18,612,281 - 18,613,193 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 18,205,647 - 18,206,253 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 18,318,339 - 18,318,942 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 18,646,119 - 18,646,759 (-) NCBI UU_Cfam_GSD_1.0
OXT Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 32,605,586 - 32,606,546 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 32,605,586 - 32,606,449 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 36,975,726 - 36,976,589 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
OXT Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 33,749,520 - 33,750,981 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 33,750,108 - 33,750,968 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666071 10,763,922 - 10,764,819 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Oxt
.
Predicted Target Of
Count of predictions: 44 Count of miRNA genes: 41 Interacting mature miRNAs: 42 Transcripts: ENSRNOT00000028829 Prediction methods: Microtar, Rnahybrid Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1358204 Insglur1 Insulin/glucose ratio QTL 1 3.8 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 3 115638168 135181505 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1331758 Bp207 Blood pressure QTL 207 2.848 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 112287552 135181505 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
RH142212
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 117,782,845 - 117,782,996 (+) MAPPER mRatBN7.2 Rnor_6.0 3 123,106,890 - 123,107,040 NCBI Rnor6.0 Rnor_5.0 3 129,605,018 - 129,605,168 UniSTS Rnor5.0 RGSC_v3.4 3 118,194,415 - 118,194,565 UniSTS RGSC3.4 Celera 3 116,593,705 - 116,593,855 UniSTS Cytogenetic Map 3 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
2
3
3
67
14
11
5
2
5
1
33
10
63
15
31
6
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028829 ⟹ ENSRNOP00000028829
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 117,782,650 - 117,783,490 (+) Ensembl Rnor_6.0 Ensembl 3 123,106,694 - 123,107,534 (+) Ensembl
RefSeq Acc Id:
NM_012996 ⟹ NP_037128
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,235,754 - 138,236,594 (+) NCBI mRatBN7.2 3 117,782,650 - 117,783,490 (+) NCBI Rnor_6.0 3 123,106,694 - 123,107,534 (+) NCBI Rnor_5.0 3 129,604,822 - 129,605,662 (+) NCBI RGSC_v3.4 3 118,194,219 - 118,195,056 (+) RGD Celera 3 116,593,509 - 116,594,349 (+) NCBI
Sequence:
TCACCGACGGTGGATCTCGGACTGAACACCAACGCCATGGCCTGCCCCAGTCTTGCTTGCTGCCTGCTTGGCCTACTGGCTCTGACCTCCGCCTGCTACATCCAGAACTGCCCCCTGGGCGGCAAGAG
hide sequence
RefSeq Acc Id:
NP_037128 ⟸ NM_012996
- Peptide Label:
preproprotein
- UniProtKB:
Q53WU2 (UniProtKB/Swiss-Prot), P01179 (UniProtKB/Swiss-Prot)
- Sequence:
MACPSLACCLLGLLALTSACYIQNCPLGGKRAALDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCATAGICCSPDGCRTDPACDPESAFSER
hide sequence
Ensembl Acc Id:
ENSRNOP00000028829 ⟸ ENSRNOT00000028829
RGD ID: 13692436 Promoter ID: EPDNEW_R2960 Type: single initiation site Name: Oxt_1 Description: oxytocin/neurophysin 1 prepropeptide SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 123,106,695 - 123,106,755 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-04-04
Oxt
oxytocin/neurophysin I prepropeptide
Oxt
oxytocin/neurophysin I prepropeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2019-04-04
Oxt
oxytocin/neurophysin I prepropeptide
Oxt
oxytocin/neurophysin 1 prepropeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-11-07
Oxt
oxytocin/neurophysin 1 prepropeptide
Oxt
oxytocin, prepropeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-24
Oxt
oxytocin, prepropeptide
Oxt
oxytocin
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Oxt
oxcytocin
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
protein synthesized by magnocellular neurons of the supraoptic and paraventricular nuclei of the hypothalamus; synthesized in ovary, thymus, kidneys, heart and vasculature
631223
gene_mapping
maps to the Bp37 QTL region and proposed to be a candidate gene for blood pressure regulation
631223
gene_process
reduces mean arterial pressure and peripheral resistance; may play a role in body fluid hemeostasis
631223
gene_regulation
biosynthesis and secretion are regulated by thyrotropin-releasing hormone (TRH)
634240
