Symbol:
Drd4
Name:
dopamine receptor D4
RGD ID:
2522
Description:
Enables dopamine binding activity; dopamine neurotransmitter receptor activity, coupled via Gi/Go; and heterocyclic compound binding activity. Involved in several processes, including learning or memory; modulation of chemical synaptic transmission; and regulation of signal transduction. Located in several cellular components, including cytoplasmic side of plasma membrane; dendrite; and perikaryon. Is active in GABA-ergic synapse; glutamatergic synapse; and synaptic membrane. Biomarker of attention deficit hyperactivity disorder and obesity. Human ortholog(s) of this gene implicated in several diseases, including Gilles de la Tourette syndrome; antisocial personality disorder; attention deficit hyperactivity disorder; conduct disorder; and substance abuse (multiple). Orthologous to human DRD4 (dopamine receptor D4); PARTICIPATES IN dopamine signaling pathway; excitatory synaptic transmission pathway; dopamine signaling pathway via D2 family of receptors; INTERACTS WITH (+)-butaclamol; 1,2-dimethylhydrazine; 3,7-dihydropurine-6-thione.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
d(2C) dopamine receptor; D(4) dopamine receptor; D4RA; dopamine D4 receptor; dopamine receptor 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DRD4 (dopamine receptor D4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Drd4 (dopamine receptor D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Drd4 (dopamine receptor D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DRD4 (dopamine receptor D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DRD4 (dopamine receptor D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Drd4 (dopamine receptor D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DRD4 (dopamine receptor D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DRD4 (dopamine receptor D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Drd4 (dopamine receptor D4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PGAP6 (post-GPI attachment to proteins 6) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Drd4 (dopamine receptor D4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
DRD4 (dopamine receptor D4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
drd4a (dopamine receptor D4a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
drd4b (dopamine receptor D4b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
drd4-rs (dopamine receptor D4 related sequence)
Alliance
DIOPT (OMA|OrthoFinder|OrthoInspector)
Caenorhabditis elegans (roundworm):
C24A8.6
Alliance
DIOPT (Ensembl Compara|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
drd4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 205,825,937 - 205,829,124 (+) NCBI GRCr8 mRatBN7.2 1 196,396,366 - 196,400,824 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 196,396,366 - 196,399,553 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 204,741,809 - 204,744,982 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 211,868,591 - 211,871,768 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 204,542,729 - 204,545,906 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 214,278,296 - 214,282,818 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 214,278,296 - 214,281,483 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 221,195,844 - 221,200,366 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 201,485,597 - 201,488,784 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 201,636,931 - 201,640,119 (+) NCBI Celera 1 194,030,237 - 194,033,424 (+) NCBI Celera RH 3.4 Map 1 1437.21 RGD Cytogenetic Map 1 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
(+)-butaclamol (EXP) 1,2-dimethylhydrazine (EXP) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 3',5'-cyclic AMP (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3,7-dihydropurine-6-thione (EXP) 4,4'-sulfonyldiphenol (ISO) acrylamide (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) Aroclor 1254 (EXP) arsenite(3-) (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bicalutamide (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) Butylbenzyl phthalate (ISO) cadmium atom (EXP,ISO) cadmium dichloride (ISO) chlorpyrifos (EXP) choline (ISO) cisplatin (ISO) clozapine (EXP,ISO) cocaine (EXP,ISO) copper atom (EXP) copper(0) (EXP) decabromodiphenyl ether (EXP) dextran sulfate (ISO) diazinon (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dieldrin (EXP) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) Dimethylphosphate (ISO) dopamine (EXP,ISO) dorsomorphin (ISO) fenvalerate (EXP) flavonoids (EXP) folic acid (ISO) fucoxanthin (ISO) glyphosate (ISO) gold atom (EXP) gold(0) (EXP) GSK-J4 (ISO) haloperidol (EXP,ISO) hydralazine (ISO) ketoconazole (ISO) L-methionine (ISO) maneb (ISO) mercaptopurine (EXP) mercury atom (EXP) mercury dibromide (ISO) mercury(0) (EXP) methamphetamine (ISO) methylmercury chloride (ISO) methylphenidate (ISO) morphine (EXP) N-(1-benzyl-2-methylpyrrolidin-3-yl)-5-chloro-2-methoxy-4-(methylamino)benzamide (ISO) N-Methylspiperone (EXP) naloxone (ISO) niclosamide (ISO) okadaic acid (ISO) oxidopamine (EXP) ozone (ISO) paraquat (EXP,ISO) phenylmercury acetate (ISO) picrotoxin (EXP) progesterone (ISO) purine-6-thiol (EXP) pyridaben (ISO) quercetin (EXP) quinpirole (EXP) resveratrol (ISO) ropinirole (ISO) SB 431542 (ISO) silver atom (EXP) silver(0) (EXP) sodium chloride (EXP) spiperone (EXP,ISO) temozolomide (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) valproic acid (ISO) vinclozolin (EXP) zinc atom (EXP) zinc(0) (EXP)
Biological Process
adenylate cyclase-inhibiting dopamine receptor signaling pathway (IEA,ISO,ISS) adenylate cyclase-modulating G protein-coupled receptor signaling pathway (IBA) adult locomotory behavior (IEA,ISO) arachidonate secretion (IEA,ISO) associative learning (IMP) behavioral fear response (IMP) behavioral response to cocaine (IEA,ISO) chemical synaptic transmission (IBA) circadian rhythm (IEP) fear response (IEA,ISO) G protein-coupled dopamine receptor signaling pathway (IDA) G protein-coupled receptor signaling pathway (IEA) G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger (IBA) G protein-coupled serotonin receptor signaling pathway (IEA) inhibitory postsynaptic potential (IEA,ISO) intracellular calcium ion homeostasis (IEA,ISO) modulation of inhibitory postsynaptic potential (IDA) negative regulation of protein secretion (IEA,ISO) negative regulation of synaptic transmission (IDA) negative regulation of synaptic transmission, GABAergic (IDA) negative regulation of vascular associated smooth muscle cell migration (IDA) negative regulation of vascular associated smooth muscle cell proliferation (IDA) olfactory learning (IMP) phospholipase C-activating dopamine receptor signaling pathway (IEA,ISO) photoperiodism (IEP) positive regulation of excitatory postsynaptic potential (IMP) positive regulation of MAP kinase activity (ISO) positive regulation of penile erection (IDA) prepulse inhibition (IMP) presynaptic modulation of chemical synaptic transmission (EXP,IDA) regulation of biological quality (IEA) regulation of calcium-mediated signaling (IMP) regulation of circadian rhythm (IEA,ISO,ISS) regulation of dopamine metabolic process (IEA,ISO) regulation of locomotion (IEA) regulation of neurotransmitter secretion (IMP) regulation of postsynaptic membrane neurotransmitter receptor levels (EXP,IDA,IEP) regulation of postsynaptic neurotransmitter receptor internalization (IEA,ISO) regulation of protein kinase A signaling (IDA) response to amphetamine (IEA,ISO) response to epinephrine (IEP) response to ethanol (IEP) response to histamine (IEA,ISO) response to light stimulus (IEP) response to steroid hormone (IEP) response to thyroid hormone (IEP) retina development in camera-type eye (IEP) rhythmic process (IEA) short-term memory (IMP) signal transduction (IEA) synaptic transmission, dopaminergic (IEA,IMP)
Cellular Component
axon (IDA) axon terminus (IDA) cell cortex (IDA) centrosome (IEA,ISO) cytoplasm (IDA) cytoplasmic side of plasma membrane (IDA) dendrite (IBA,IDA) dendrite terminus (IDA) dendritic microtubule (IDA) dendritic shaft (IDA) dendritic spine (IDA) endoplasmic reticulum (IDA) GABA-ergic synapse (EXP,IDA) glutamatergic synapse (EXP,IDA,IEA,IEP,ISO) Golgi apparatus (IDA) membrane (IEA,ISO) mitochondrion (IDA) neuronal cell body (IDA) perikaryon (IDA) plasma membrane (IBA,IDA,IEA,ISO,ISS) postsynapse (IEA) postsynaptic membrane (IDA) presynapse (IDA) presynaptic membrane (IDA) synapse (IDA) terminal bouton (IDA)
Molecular Function
dopamine binding (IDA,IEA,IPI,ISO) dopamine neurotransmitter receptor activity (IEA,ISO) dopamine neurotransmitter receptor activity, coupled via Gi/Go (IDA,IEA,ISO) epinephrine binding (IEA,ISO) G protein-coupled receptor activity (IEA) G protein-coupled serotonin receptor activity (IBA) heterocyclic compound binding (IDA,IPI) identical protein binding (IEA,ISO) metal ion binding (IEA) neurotransmitter receptor activity (IBA) norepinephrine binding (IEA,ISO) protein binding (IPI,ISO) SH3 domain binding (IEA,ISO)
1.
Dopamine D4 receptor repeat: analysis of different native and mutant forms of the human and rat genes.
Asghari V, etal., Mol Pharmacol. 1994 Aug;46(2):364-73.
2.
Dopamine D4 receptor-mediated presynaptic inhibition of GABAergic transmission in the rat supraoptic nucleus.
Azdad K, etal., J Neurophysiol 2003 Aug;90(2):559-65. Epub 2003 Apr 23.
3.
Daily oscillation of gene expression in the retina is phase-advanced with respect to the pineal gland.
Bai L, etal., Brain Res. 2008 Apr 8;1203:89-96. Epub 2008 Feb 9.
4.
No evidence for a major gene effect of the dopamine D4 receptor gene in the susceptibility to Gilles de la Tourette syndrome in five Canadian families.
Barr CL, etal., Am J Med Genet. 1996 May 31;67(3):301-5.
5.
The physiology, signaling, and pharmacology of dopamine receptors.
Beaulieu JM and Gainetdinov RR, Pharmacol Rev. 2011 Mar;63(1):182-217. doi: 10.1124/pr.110.002642. Epub 2011 Feb 8.
6.
A gene x gene interaction between DRD2 and DRD4 is associated with conduct disorder and antisocial behavior in males.
Beaver KM, etal., Behav Brain Funct. 2007 Jun 22;3:30.
7.
The dopamine D4 receptor gene exon III polymorphism is associated with novelty seeking in 15-year-old males from a high-risk community sample.
Becker K, etal., J Neural Transm (Vienna). 2005 Jun;112(6):847-58. Epub 2004 Oct 27.
8.
The genetic association database.
Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
9.
DRD4 gene variants and sustained attention in attention deficit hyperactivity disorder (ADHD): effects of associated alleles at the VNTR and -521 SNP.
Bellgrove MA, etal., Am J Med Genet B Neuropsychiatr Genet. 2005 Jul 5;136B(1):81-6.
10.
The anabolic androgenic steroid nandrolone decanoate affects mRNA expression of dopaminergic but not serotonergic receptors.
Birgner C, etal., Brain Res. 2008 Nov 13;1240:221-8. doi: 10.1016/j.brainres.2008.09.003. Epub 2008 Sep 13.
11.
Cognitive impairment and gene expression alterations in a rodent model of binge eating disorder.
Chawla A, etal., Physiol Behav. 2017 Oct 15;180:78-90. doi: 10.1016/j.physbeh.2017.08.004. Epub 2017 Aug 15.
12.
DRD4 Exon 3 Gene Polymorphisms in Patients Diagnosed with Polysubstance Use Disorder and Co-Occurrence of a Depressive Episode.
Chmielowiec K, etal., Genes (Basel). 2021 Nov 20;12(11):1834. doi: 10.3390/genes12111834.
13.
The conditioning of intervention effects on early adolescent alcohol use by maternal involvement and dopamine receptor D4 (DRD4) and serotonin transporter linked polymorphic region (5-HTTLPR) genetic variants.
Cleveland HH, etal., Dev Psychopathol. 2015 Feb;27(1):51-67. doi: 10.1017/S0954579414001291.
14.
Studies of the 48 bp repeat polymorphism of the DRD4 gene in impulsive, compulsive, addictive behaviors: Tourette syndrome, ADHD, pathological gambling, and substance abuse.
Comings DE, etal., Am J Med Genet. 1999 Aug 20;88(4):358-68.
15.
Increased prevalence of the seven-repeat variant of the dopamine D4 receptor gene in patients with obsessive-compulsive disorder with tics.
Cruz C, etal., Neurosci Lett. 1997 Aug 1;231(1):1-4.
16.
[Relationship between dopamine D4 receptor gene polymorphisms and primary nocturnal enuresis].
Dai XM, etal., Zhongguo Dang Dai Er Ke Za Zhi. 2008 Oct;10(5):607-10.
17.
The association of exon 3 VNTR polymorphism of the dopamine receptor D4 (DRD4) gene with alcoholism in Mexican Americans.
Du Y, etal., Psychiatry Res. 2010 May 30;177(3):358-60. doi: 10.1016/j.psychres.2010.02.021. Epub 2010 Apr 1.
18.
A haplotype relative risk study of the dopamine D4 receptor (DRD4) exon III repeat polymorphism and attention deficit hyperactivity disorder (ADHD).
Eisenberg J, etal., Am J Med Genet. 2000 Jun 12;96(3):258-61.
19.
Meta-analysis of the association between the 7-repeat allele of the dopamine D(4) receptor gene and attention deficit hyperactivity disorder.
Faraone SV, etal., Am J Psychiatry. 2001 Jul;158(7):1052-7.
20.
Dopamine D4 receptors inhibit depolarization-induced GABA release in the rat subthalamic nucleus.
Floran B, etal., Eur J Pharmacol. 2004 Sep 13;498(1-3):97-102.
21.
Dopaminergic regulation of inhibitory and excitatory transmission in the basolateral amygdala-prefrontal cortical pathway.
Floresco SB and Tse MT, J Neurosci. 2007 Feb 21;27(8):2045-57.
22.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
23.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
24.
Circadian-related heteromerization of adrenergic and dopamine D4 receptors modulates melatonin synthesis and release in the pineal gland.
González S, etal., PLoS Biol. 2012;10(6):e1001347. doi: 10.1371/journal.pbio.1001347. Epub 2012 Jun 19.
25.
Dopamine D4 receptor excitation of lateral habenula neurons via multiple cellular mechanisms.
Good CH, etal., J Neurosci. 2013 Oct 23;33(43):16853-64. doi: 10.1523/JNEUROSCI.1844-13.2013.
26.
Differential Susceptibility: The Genetic Moderation of Peer Pressure on Alcohol Use.
Griffin AM, etal., J Youth Adolesc. 2015 Oct;44(10):1841-53. doi: 10.1007/s10964-015-0344-7. Epub 2015 Aug 26.
27.
CLIC6, a member of the intracellular chloride channel family, interacts with dopamine D(2)-like receptors.
Griffon N, etal., Brain Res Mol Brain Res 2003 Sep 10;117(1):47-57.
28.
Bidirectional regulation of Ca2+/calmodulin-dependent protein kinase II activity by dopamine D4 receptors in prefrontal cortex.
Gu Z and Yan Z, Mol Pharmacol. 2004 Oct;66(4):948-55. doi: 10.1124/mol.104.001404. Epub 2004 Jun 30.
29.
Activation of dopamine D4 receptors induces synaptic translocation of Ca2+/calmodulin-dependent protein kinase II in cultured prefrontal cortical neurons.
Gu Z, etal., Mol Pharmacol. 2006 Mar;69(3):813-22. Epub 2005 Dec 19.
30.
[Association analysis of dopamine D4 receptor gene polymorphism and attention deficit hyperactivity disorder with/without disruptive behavior disorder].
Guan LL, etal., Beijing Da Xue Xue Bao. 2007 Jun 18;39(3):233-6.
31.
Impulsivity and Concussion in Juvenile Rats: Examining Molecular and Structural Aspects of the Frontostriatal Pathway.
Hehar H, etal., PLoS One. 2015 Oct 8;10(10):e0139842. doi: 10.1371/journal.pone.0139842. eCollection 2015.
32.
Dopamine receptor D4 gene -521C/T polymorphism is associated with opioid dependence through cold-pain responses.
Ho AM, etal., Ann N Y Acad Sci. 2008 Oct;1139:20-6. doi: 10.1196/annals.1432.054.
33.
Dopaminergic and noradrenergic gene polymorphisms and response to methylphenidate in korean children with attention-deficit/hyperactivity disorder: is there an interaction?
Hong SB, etal., J Child Adolesc Psychopharmacol. 2012 Oct;22(5):343-52. doi: 10.1089/cap.2011.0076.
34.
A dyslexia susceptibility locus (DYX7) linked to dopamine D4 receptor (DRD4) region on chromosome 11p15.5.
Hsiung GY, etal., Am J Med Genet B Neuropsychiatr Genet. 2004 Feb 15;125B(1):112-9.
35.
Association between the 120-bp duplication of the dopamine D4 receptor gene and attention deficit hyperactivity disorder: genetic and molecular analyses.
Kereszturi E, etal., Am J Med Genet B Neuropsychiatr Genet. 2007 Mar 5;144B(2):231-6.
36.
Thyroid hormone and adrenergic signaling interact to control pineal expression of the dopamine receptor D4 gene (Drd4).
Kim JS, etal., Mol Cell Endocrinol. 2010 Jan 15;314(1):128-35. doi: 10.1016/j.mce.2009.05.013. Epub 2009 May 29.
37.
Localization and regulation of dopamine receptor D4 expression in the adult and developing rat retina.
Klitten LL, etal., Exp Eye Res. 2008 Nov;87(5):471-7. Epub 2008 Aug 20.
38.
Certain 1,4-disubstituted aromatic piperidines and piperazines with extreme selectivity for the dopamine D4 receptor interact with a common receptor microdomain.
Kortagere S, etal., Mol Pharmacol. 2004 Dec;66(6):1491-9. Epub 2004 Sep 24.
39.
Immunohistochemical localization of dopamine receptor subtypes (D1R-D5R) in Alzheimer's disease brain.
Kumar U and Patel SC, Brain Res. 2007 Feb 2;1131(1):187-96. Epub 2006 Dec 19.
40.
Transmission disequilibrium testing of dopamine-related candidate gene polymorphisms in ADHD: confirmation of association of ADHD with DRD4 and DRD5.
Kustanovich V, etal., Mol Psychiatry 2004 Jul;9(7):711-7.
41.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
42.
Dopamine D4 receptor gene polymorphism is associated with attention deficit hyperactivity disorder.
LaHoste GJ, etal., Mol Psychiatry 1996 May;1(2):121-4.
43.
Novelty seeking: interaction between parental alcohol use and dopamine D4 receptor gene exon III polymorphism over 17 years.
Lahti J, etal., Psychiatr Genet. 2005 Jun;15(2):133-9. doi: 10.1097/00041444-200506000-00010.
44.
Dopamine D4 receptor (DRD4) gene polymorphism is associated with attachment disorganization in infants.
Lakatos K, etal., Mol Psychiatry. 2000 Nov;5(6):633-7. doi: 10.1038/sj.mp.4000773.
45.
A subpopulation of neurons in the medial prefrontal cortex encodes emotional learning with burst and frequency codes through a dopamine D4 receptor-dependent basolateral amygdala input.
Laviolette SR, etal., J Neurosci. 2005 Jun 29;25(26):6066-75.
46.
The usefulness of the spontaneously hypertensive rat to model attention-deficit/hyperactivity disorder (ADHD) may be explained by the differential expression of dopamine-related genes in the brain.
Li Q, etal., Neurochem Int. 2007 May;50(6):848-57. Epub 2007 Mar 1.
47.
Association analysis of polymorphisms in the DRD4 gene and heroin abuse in Chinese subjects.
Li T, etal., Am J Med Genet. 2000 Oct 9;96(5):616-21. doi: 10.1002/1096-8628(20001009)96:5<616::aid-ajmg6>3.0.co;2-7.
48.
Variable number tandem repeats in dopamine receptor D4 in Tourette's syndrome.
Liu S, etal., Mov Disord. 2014 Nov;29(13):1687-91. doi: 10.1002/mds.26027. Epub 2014 Sep 25.
49.
Multiple marker analysis at the promoter region of the DRD4 gene and ADHD: evidence of linkage and association with the SNP -616.
Lowe N, etal., Am J Med Genet B Neuropsychiatr Genet. 2004 Nov 15;131B(1):33-7.
50.
Selective dopamine D4 receptor antagonists reverse apomorphine-induced blockade of prepulse inhibition.
Mansbach RS, etal., Psychopharmacology (Berl). 1998 Jan;135(2):194-200. doi: 10.1007/s002130050501.
51.
Effects of neonatal 6-hydroxydopamine lesion on the gene expression profile in young adult rats.
Masuo Y, etal., Neurosci Lett. 2002 Dec 25;335(2):124-8. doi: 10.1016/s0304-3940(02)01167-9.
52.
PD-168077, a selective dopamine D4 receptor agonist, induces penile erection when injected into the paraventricular nucleus of male rats.
Melis MR, etal., Neurosci Lett. 2005 Apr 29;379(1):59-62. Epub 2005 Jan 12.
53.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
54.
Polymorphisms in the dopamine D4 receptor gene and attention-deficit hyperactivity disorder.
Mill J, etal., Neuroreport. 2003 Aug 6;14(11):1463-6.
55.
Fibrosis progression in HCV carriers with mild hepatitis who possess the high-repetition variant of the DRD4 gene, a genetic marker for binge-drinking and risk-seeking behavior: a longitudinal study.
Minisini R, etal., Alcohol Clin Exp Res. 2013 Jun;37(6):891-5. doi: 10.1111/acer.12047. Epub 2013 Jan 8.
56.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
57.
Human dopamine D4 receptor gene: frequent occurrence of a null allele and observation of homozygosity.
Nothen MM, etal., Hum Mol Genet. 1994 Dec;3(12):2207-12.
58.
The rat dopamine D4 receptor: sequence, gene structure, and demonstration of expression in the cardiovascular system.
O'Malley KL, etal., New Biol 1992 Feb;4(2):137-46.
59.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
60.
Prefrontal dopamine D4 receptors are involved in encoding fear extinction.
Pfeiffer UJ and Fendt M, Neuroreport. 2006 May 29;17(8):847-50.
61.
Colocalization of dopamine receptor subtypes with dopamine and cAMP-regulated phosphoprotein (DARPP-32) in rat brain.
Rajput PS, etal., Neurosci Res. 2009 Sep;65(1):53-63. Epub 2009 May 22.
62.
GOA pipeline
RGD automated data pipeline
63.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
64.
Dopamine D4 receptor expression in rat kidney: evidence for pre- and postjunctional localization.
Ricci A, etal., J Histochem Cytochem. 2002 Aug;50(8):1091-6. doi: 10.1177/002215540205000811.
65.
Expression of D4 dopamine receptors in striatonigral and striatopallidal neurons in the rat striatum.
Rivera A, etal., Brain Res. 2003 Oct 31;989(1):35-41.
66.
Dopamine D4 receptors are heterogeneously distributed in the striosomes/matrix compartments of the striatum.
Rivera A, etal., J Neurochem 2002 Jan;80(2):219-29.
67.
Tonic modulation of inhibition by dopamine D4 receptors in the rat hippocampus.
Romo-Parra H, etal., Hippocampus. 2005;15(2):254-9.
68.
Witnessing substance use increases same-day antisocial behavior among at-risk adolescents: Gene-environment interaction in a 30-day ecological momentary assessment study.
Russell MA, etal., Dev Psychopathol. 2016 Nov;28(4pt2):1441-1456. doi: 10.1017/S0954579415001182. Epub 2015 Dec 9.
69.
Dopamine D4 receptor exon III alleles and variation of novelty seeking in alcoholics.
Sander T, etal., Am J Med Genet. 1997 Sep 19;74(5):483-7. doi: 10.1002/(sici)1096-8628(19970919)74:5<483::aid-ajmg5>3.0.co;2-p.
70.
Ethanol concentration-dependent alterations in gene expression during acute binge drinking in the HIV-1 transgenic rat.
Sarkar S and Chang SL, Alcohol Clin Exp Res. 2013 Jul;37(7):1082-90. doi: 10.1111/acer.12077. Epub 2013 Feb 15.
71.
Dopamine D4 receptors elevated in schizophrenia.
Seeman P, etal., Nature. 1993 Sep 30;365(6445):441-5.
72.
Polymorphisms of the dopamine D4 receptor, clinical outcome, and cortical structure in attention-deficit/hyperactivity disorder.
Shaw P, etal., Arch Gen Psychiatry. 2007 Aug;64(8):921-31.
73.
Catechol-O-methyltransferase and dopamine receptor D4 gene variants: Possible association with substance abuse in Bangladeshi male.
Sonia JA, etal., PLoS One. 2021 Feb 5;16(2):e0246462. doi: 10.1371/journal.pone.0246462. eCollection 2021.
74.
Presynaptic dopamine D(4) receptor localization in the rat nucleus accumbens shell.
Svingos AL, etal., Synapse. 2000 Jun 1;36(3):222-32.
75.
Altered mRNA expression of monoaminergic candidate genes in the blood of children with attention deficit hyperactivity disorder and autism spectrum disorder.
Taurines R, etal., World J Biol Psychiatry. 2011 Sep;12 Suppl 1:104-8.
76.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
77.
Lack of association of dopamine D4 receptor gene polymorphisms with ADHD subtypes in a population sample of twins.
Todd RD, etal., Am J Med Genet. 2001 Jul 8;105(5):432-8.
78.
Dopamine D4 Receptor Gene Exon III VNTR Variant Influences Smoking Status in Turkish Population.
Uysal MA, etal., Noro Psikiyatr Ars. 2019 Oct 4;56(4):248-252. doi: 10.29399/npa.23408. eCollection 2019 Dec.
79.
Dopamine D4 receptor gene exon III polymorphism associated with binge drinking attitudinal phenotype.
Vaughn MG, etal., Alcohol. 2009 May;43(3):179-84. doi: 10.1016/j.alcohol.2009.02.001.
80.
Multivariate analysis of dopaminergic gene variants as risk factors of heroin dependence.
Vereczkei A, etal., PLoS One. 2013 Jun 28;8(6):e66592. doi: 10.1371/journal.pone.0066592. Print 2013.
81.
Reduction of renal dopamine receptor expression in obese Zucker rats: role of sex and angiotensin II.
Wang X, etal., Am J Physiol Renal Physiol. 2010 Nov;299(5):F1164-70. doi: 10.1152/ajprenal.00604.2009. Epub 2010 Sep 1.
82.
Dopamine D4 receptors modulate GABAergic signaling in pyramidal neurons of prefrontal cortex.
Wang X, etal., J Neurosci. 2002 Nov 1;22(21):9185-93. doi: 10.1523/JNEUROSCI.22-21-09185.2002.
83.
Regulation of NMDA receptors by dopamine D4 signaling in prefrontal cortex.
Wang X, etal., J Neurosci. 2003 Oct 29;23(30):9852-61.
84.
Cortical localization of dopamine D4 receptors in the rat brain--immunocytochemical study.
Wedzony K, etal., J Physiol Pharmacol. 2000 Jun;51(2):205-21.
85.
Dopamine D4 receptors inhibit proliferation and migration of vascular smooth muscle cells induced by insulin via down-regulation of insulin receptor expression.
Yu C, etal., Cardiovasc Diabetol. 2014 Jun 2;13:97. doi: 10.1186/1475-2840-13-97.
86.
Cellular mechanisms for dopamine D4 receptor-induced homeostatic regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors.
Yuen EY and Yan Z, J Biol Chem. 2011 Jul 15;286(28):24957-65. doi: 10.1074/jbc.M111.221416. Epub 2011 May 27.
87.
Plasticity of dopamine D4 receptors in rat forebrain: temporal association with motor hyperactivity following neonatal 6-hydroxydopamine lesioning.
Zhang K, etal., Neuropsychopharmacology 2002 May;26(5):625-33.
88.
Regulation of working memory by dopamine D4 receptor in rats.
Zhang K, etal., Neuropsychopharmacology. 2004 Sep;29(9):1648-55.
89.
A family-based association study of dopamine receptor D4 and mental retardation in Qinba region of China.
Zhang K, etal., Neurosci Lett. 2012 May 10;516(1):1-4. doi: 10.1016/j.neulet.2012.02.017. Epub 2012 Feb 15.
90.
Effects of dopamine D4 receptor-selective antagonists on motor hyperactivity in rats with neonatal 6-hydroxydopamine lesions.
Zhang K, etal., Psychopharmacology (Berl). 2002 Apr;161(1):100-6. doi: 10.1007/s00213-002-1018-1. Epub 2002 Mar 6.
91.
Methylation quantitative locus rs3758653 in the DRD4 gene is associated with duration from first heroin exposure to addiction.
Zhang R, etal., Brain Res. 2022 Jan 15;1775:147746. doi: 10.1016/j.brainres.2021.147746. Epub 2021 Dec 2.
Drd4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 205,825,937 - 205,829,124 (+) NCBI GRCr8 mRatBN7.2 1 196,396,366 - 196,400,824 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 196,396,366 - 196,399,553 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 204,741,809 - 204,744,982 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 211,868,591 - 211,871,768 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 204,542,729 - 204,545,906 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 214,278,296 - 214,282,818 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 214,278,296 - 214,281,483 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 221,195,844 - 221,200,366 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 201,485,597 - 201,488,784 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 201,636,931 - 201,640,119 (+) NCBI Celera 1 194,030,237 - 194,033,424 (+) NCBI Celera RH 3.4 Map 1 1437.21 RGD Cytogenetic Map 1 q41 NCBI
DRD4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 637,269 - 640,706 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 637,269 - 640,706 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 637,269 - 640,706 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 627,305 - 630,703 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 627,304 - 630,703 NCBI Celera 11 702,422 - 705,821 (+) NCBI Celera Cytogenetic Map 11 p15.5 NCBI HuRef 11 452,513 - 456,039 (+) NCBI HuRef CHM1_1 11 636,234 - 639,634 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 685,792 - 689,369 (+) NCBI T2T-CHM13v2.0
Drd4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 140,871,931 - 140,874,868 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 140,871,919 - 140,876,377 (+) Ensembl GRCm39 Ensembl GRCm38 7 141,291,974 - 141,296,464 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 141,292,006 - 141,296,464 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 148,477,905 - 148,480,900 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 141,143,326 - 141,146,321 (+) NCBI MGSCv36 mm8 Celera 7 141,085,754 - 141,088,749 (+) NCBI Celera Cytogenetic Map 7 F5 NCBI cM Map 7 86.6 NCBI
Drd4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955476 11,424,411 - 11,426,960 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955476 11,424,347 - 11,426,962 (-) NCBI ChiLan1.0 ChiLan1.0
DRD4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 3,007,058 - 3,019,627 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 2,222,678 - 2,235,881 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 640,401 - 646,775 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 671,445 - 674,412 (+) NCBI panpan1.1 PanPan1.1 panPan2
DRD4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Dog10K_Boxer_Tasha 18 25,378,476 - 25,381,179 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 26,314,100 - 26,316,803 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 26,314,085 - 26,316,803 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 25,823,586 - 25,826,358 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 25,468,566 - 25,471,386 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 26,081,003 - 26,083,706 (+) NCBI UU_Cfam_GSD_1.0
Drd4
DRD4
DRD4
Drd4
.
Predicted Target Of
Count of predictions: 40 Count of miRNA genes: 40 Interacting mature miRNAs: 40 Transcripts: ENSRNOT00000024137 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1359018 Hrtrt20 Heart rate QTL 20 3.08 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 185356336 202902618 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 631260 Tcas2 Tongue tumor susceptibility QTL 2 4.93 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 192485903 199050587 Rat 619614 Bp78 Blood pressure QTL 78 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 169112897 197261052 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6480780 Insul18 Insulin level QTL 18 4.11 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 189607473 200611765 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
D1Wox57
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 196,397,155 - 196,397,369 (+) MAPPER mRatBN7.2 Rnor_6.0 1 214,279,086 - 214,279,299 NCBI Rnor6.0 Rnor_5.0 1 221,196,634 - 221,196,847 UniSTS Rnor5.0 RGSC_v3.4 1 201,486,387 - 201,486,600 UniSTS RGSC3.4 Celera 1 194,031,027 - 194,031,240 UniSTS Cytogenetic Map 1 q41 UniSTS
RH94697
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 196,396,059 - 196,396,256 (+) MAPPER mRatBN7.2 Rnor_6.0 1 214,277,990 - 214,278,186 NCBI Rnor6.0 Rnor_5.0 1 221,195,538 - 221,195,734 UniSTS Rnor5.0 RGSC_v3.4 1 201,485,291 - 201,485,487 UniSTS RGSC3.4 Celera 1 194,029,931 - 194,030,127 UniSTS Cytogenetic Map 1 q41 UniSTS
RH142302
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 196,396,372 - 196,396,564 (+) MAPPER mRatBN7.2 Rnor_6.0 1 214,278,303 - 214,278,494 NCBI Rnor6.0 Rnor_5.0 1 221,195,851 - 221,196,042 UniSTS Rnor5.0 RGSC_v3.4 1 201,485,604 - 201,485,795 UniSTS RGSC3.4 Celera 1 194,030,244 - 194,030,435 UniSTS RH 3.4 Map 1 1437.21 UniSTS Cytogenetic Map 1 q41 UniSTS
BI284462
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 196,399,051 - 196,399,214 (+) MAPPER mRatBN7.2 Rnor_6.0 1 214,280,982 - 214,281,144 NCBI Rnor6.0 Rnor_5.0 1 221,198,530 - 221,198,692 UniSTS Rnor5.0 RGSC_v3.4 1 201,488,283 - 201,488,445 UniSTS RGSC3.4 Celera 1 194,032,923 - 194,033,085 UniSTS RH 3.4 Map 1 1436.4 UniSTS Cytogenetic Map 1 q41 UniSTS
Drd4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 196,396,688 - 196,398,331 (+) MAPPER mRatBN7.2 Rnor_6.0 1 214,278,619 - 214,280,261 NCBI Rnor6.0 Rnor_5.0 1 221,196,167 - 221,197,809 UniSTS Rnor5.0 RGSC_v3.4 1 201,485,920 - 201,487,562 UniSTS RGSC3.4 Celera 1 194,030,560 - 194,032,202 UniSTS Cytogenetic Map 1 q41 UniSTS
UniSTS:142868
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 196,398,343 - 196,398,500 (+) MAPPER mRatBN7.2 Rnor_6.0 1 214,280,274 - 214,280,430 NCBI Rnor6.0 Rnor_5.0 1 221,197,822 - 221,197,978 UniSTS Rnor5.0 RGSC_v3.4 1 201,487,575 - 201,487,731 UniSTS RGSC3.4 Celera 1 194,032,215 - 194,032,371 UniSTS Cytogenetic Map 1 q41 UniSTS
Drd4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 196,399,334 - 196,399,437 (+) MAPPER mRatBN7.2 Rnor_6.0 1 214,281,265 - 214,281,367 NCBI Rnor6.0 Rnor_5.0 1 221,198,813 - 221,198,915 UniSTS Rnor5.0 RGSC_v3.4 1 201,488,566 - 201,488,668 UniSTS RGSC3.4 Celera 1 194,033,206 - 194,033,308 UniSTS Cytogenetic Map 1 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
7
38
60
33
39
10
20
10
6
106
71
47
18
33
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024137 ⟹ ENSRNOP00000024137
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 196,396,366 - 196,399,553 (+) Ensembl Rnor_6.0 Ensembl 1 214,278,296 - 214,281,483 (+) Ensembl
RefSeq Acc Id:
NM_012944 ⟹ NP_037076
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 205,825,937 - 205,829,124 (+) NCBI mRatBN7.2 1 196,396,366 - 196,399,553 (+) NCBI Rnor_6.0 1 214,278,296 - 214,281,483 (+) NCBI Rnor_5.0 1 221,195,844 - 221,200,366 (+) NCBI RGSC_v3.4 1 201,485,597 - 201,488,784 (+) RGD Celera 1 194,030,237 - 194,033,424 (+) RGD
Sequence:
AATTTCCTAGAGTGCAGAAATTCAAGCCGTGGCGGGCGGGGCGGAGCTGGACGCTGGGGGCGGGATTCCGGATAGCCCCTGACTGCAAATCCCCAGGCTCAGCGCCTTGCAGAGTCTCAGCTAGGGCG
hide sequence
RefSeq Acc Id:
XM_006230521 ⟹ XP_006230583
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 205,826,037 - 205,829,099 (+) NCBI mRatBN7.2 1 196,396,496 - 196,400,824 (+) NCBI Rnor_6.0 1 214,278,426 - 214,282,818 (+) NCBI Rnor_5.0 1 221,195,844 - 221,200,366 (+) NCBI
Sequence:
ATGGGGAACAGCAGCGCTACTGGTGACGGTGGGCTGTTGGCCGGGCGTGGGCCAGAGTCCTTAG
hide sequence
RefSeq Acc Id:
NP_037076 ⟸ NM_012944
- UniProtKB:
Q62610 (UniProtKB/Swiss-Prot), P30729 (UniProtKB/Swiss-Prot), F1LLX2 (UniProtKB/TrEMBL), A6HXT7 (UniProtKB/TrEMBL)
- Sequence:
MGNSSATGDGGLLAGRGPESLGTGTGLGGAGAGAAALVGGVLLIGMVLAGNSLVCVSVASERILQTPTNYFIVSLAAADLLLAVLVLPLFVYSEGGVWLLSPRLCDTLMAMDVMLCTASIFNLCAISV
hide sequence
RefSeq Acc Id:
XP_006230583 ⟸ XM_006230521
- Peptide Label:
isoform X1
- UniProtKB:
Q62610 (UniProtKB/Swiss-Prot), P30729 (UniProtKB/Swiss-Prot)
- Sequence:
MGNSSATGDGGLLAGRGPESLGTGTGLGGAGAGAAALVGGVLLIGMVLAGNSLVCVSVASERIL
hide sequence
Ensembl Acc Id:
ENSRNOP00000024137 ⟸ ENSRNOT00000024137
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Drd4
dopamine receptor D4
dopamine receptor 4
Name updated
1299863 APPROVED
2002-06-10
Drd4
Dopamine receptor D4
Symbol and Name status set to approved
70586 APPROVED
