Symbol:
Fes
Name:
FES proto-oncogene, tyrosine kinase
RGD ID:
1564385
Description:
Predicted to enable several functions, including immunoglobulin receptor binding activity; microtubule binding activity; and non-membrane spanning protein tyrosine kinase activity. Involved in cardiac muscle cell proliferation and myoblast proliferation. Predicted to be located in several cellular components, including cytoplasmic side of plasma membrane; focal adhesion; and microtubule cytoskeleton. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in esophagus squamous cell carcinoma; hepatocellular carcinoma; and lung adenocarcinoma. Orthologous to human FES (FES proto-oncogene, tyrosine kinase); PARTICIPATES IN interleukin-4 signaling pathway; vascular endothelial growth factor signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
feline sarcoma oncogene; LOC361597; RGD1564385; similar to tyrosine kinase Fps/Fes; tyrosine-protein kinase Fes/Fps
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FES (FES proto-oncogene, tyrosine kinase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Fes (feline sarcoma oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fes (FES proto-oncogene, tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FES (FES proto-oncogene, tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FES (FES proto-oncogene, tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fes (FES proto-oncogene, tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FES (FES proto-oncogene, tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FES (FES proto-oncogene, tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fes (FES proto-oncogene, tyrosine kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
FOXN1 (forkhead box N1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
FES (FES proto-oncogene, tyrosine kinase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fes (feline sarcoma oncogene)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fes (FES proto-oncogene, tyrosine kinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
FER
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F59A3.8
Alliance
DIOPT (Ensembl Compara|InParanoid|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
K09B11.5
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
T06C10.3
Alliance
DIOPT (Ensembl Compara|InParanoid|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
T25B9.4
Alliance
DIOPT (InParanoid|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
T25B9.5
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
W01B6.5
Alliance
DIOPT (Ensembl Compara|InParanoid|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
Y52D5A.2
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
Y69E1A.3
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
frk-1
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
kin-21
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
kin-24
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
kin-14
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
Y116A8C.38
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
ZK622.1
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
Y116A8C.24
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
M176.9
Alliance
DIOPT (Ensembl Compara|InParanoid|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
T21G5.1
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
fes
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 143,746,945 - 143,756,181 (-) NCBI GRCr8 mRatBN7.2 1 134,337,698 - 134,346,934 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 134,337,698 - 134,346,934 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 142,246,565 - 142,255,805 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 149,415,959 - 149,425,199 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 142,333,966 - 142,343,206 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 142,174,648 - 142,183,884 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 142,174,648 - 142,183,884 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 143,127,277 - 143,136,513 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 136,199,523 - 136,208,759 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 126,397,304 - 126,406,534 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fes Rat 1,2-dichloroethane increases expression ISO Fes (Mus musculus) 6480464 ethylene dichloride results in increased expression of FES mRNA CTD PMID:28960355 Fes Rat 1,2-dimethylhydrazine multiple interactions ISO Fes (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of FES mRNA] CTD PMID:22206623 Fes Rat 1,2-dimethylhydrazine increases expression ISO Fes (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of FES mRNA CTD PMID:22206623 Fes Rat 17beta-estradiol decreases expression ISO Fes (Mus musculus) 6480464 Estradiol results in decreased expression of FES mRNA CTD PMID:39298647 Fes Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO FES (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Fes Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Fes (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FES mRNA CTD PMID:19770486 Fes Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of FES mRNA CTD PMID:34747641 Fes Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Fes (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of FES mRNA CTD PMID:21570461 Fes Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO FES (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of FES mRNA CTD PMID:22298810 Fes Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO FES (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FES mRNA CTD PMID:28628672 Fes Rat 4,4'-sulfonyldiphenol decreases expression ISO Fes (Mus musculus) 6480464 bisphenol S results in decreased expression of FES mRNA CTD PMID:39298647 Fes Rat 4,4'-sulfonyldiphenol affects methylation ISO Fes (Mus musculus) 6480464 bisphenol S affects the methylation of FES gene CTD PMID:31683443 Fes Rat 4,4'-sulfonyldiphenol decreases methylation ISO Fes (Mus musculus) 6480464 bisphenol S results in decreased methylation of FES exon CTD PMID:33297965 Fes Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of FES mRNA CTD PMID:33150595 Fes Rat 6-propyl-2-thiouracil increases methylation EXP 6480464 Propylthiouracil results in increased methylation of FES promoter CTD PMID:33150595 Fes Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of FES mRNA CTD PMID:31881176 Fes Rat aflatoxin B1 decreases expression ISO FES (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of FES mRNA CTD PMID:27153756 Fes Rat all-trans-retinoic acid increases expression ISO FES (Homo sapiens) 6480464 Tretinoin results in increased expression of FES mRNA CTD PMID:15498508 Fes Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of FES mRNA CTD PMID:30779732 Fes Rat aristolochic acid A increases expression ISO FES (Homo sapiens) 6480464 aristolochic acid I results in increased expression of FES mRNA CTD PMID:33212167 Fes Rat arsane affects methylation ISO FES (Homo sapiens) 6480464 Arsenic affects the methylation of FES gene CTD PMID:25304211 Fes Rat arsenic atom affects methylation ISO FES (Homo sapiens) 6480464 Arsenic affects the methylation of FES gene CTD PMID:25304211 Fes Rat benzo[a]pyrene decreases expression ISO Fes (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of FES mRNA CTD PMID:19770486 Fes Rat benzo[b]fluoranthene increases expression ISO Fes (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of FES mRNA CTD PMID:26377693 Fes Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FES mRNA CTD PMID:25181051 and PMID:34947998 Fes Rat bisphenol A multiple interactions ISO FES (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FES mRNA CTD PMID:28628672 Fes Rat bisphenol F decreases expression ISO Fes (Mus musculus) 6480464 bisphenol F results in decreased expression of FES mRNA CTD PMID:38685157 Fes Rat butanal increases expression ISO FES (Homo sapiens) 6480464 butyraldehyde results in increased expression of FES mRNA CTD PMID:26079696 Fes Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of FES mRNA CTD PMID:19167457 Fes Rat caffeine increases phosphorylation ISO FES (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of FES protein CTD PMID:35688186 Fes Rat carbon nanotube increases expression ISO Fes (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of FES mRNA CTD PMID:25554681 Fes Rat cisplatin multiple interactions ISO FES (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of FES mRNA CTD PMID:27392435 Fes Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of FES mRNA CTD PMID:27523638 Fes Rat cyclosporin A decreases expression ISO FES (Homo sapiens) 6480464 Cyclosporine results in decreased expression of FES mRNA CTD PMID:25562108 Fes Rat DDE decreases expression ISO FES (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of FES mRNA CTD PMID:38568856 Fes Rat dexamethasone multiple interactions ISO FES (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FES mRNA CTD PMID:28628672 Fes Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of FES mRNA CTD PMID:30307764 Fes Rat folic acid multiple interactions ISO Fes (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of FES mRNA] CTD PMID:22206623 Fes Rat folic acid decreases expression ISO Fes (Mus musculus) 6480464 Folic Acid results in decreased expression of FES mRNA CTD PMID:25629700 Fes Rat furan increases expression EXP 6480464 furan results in increased expression of FES mRNA CTD PMID:27387713 Fes Rat gamma-tocopherol increases expression ISO Fes (Mus musculus) 6480464 Tocopherols results in increased expression of FES mRNA CTD PMID:17056531 Fes Rat indometacin multiple interactions ISO FES (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FES mRNA CTD PMID:28628672 Fes Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression ISO FES (Homo sapiens) 6480464 Methylnitronitrosoguanidine results in increased expression of FES mRNA CTD PMID:12634122 Fes Rat ozone multiple interactions ISO FES (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of FES mRNA CTD PMID:35430440 Fes Rat pentanal increases expression ISO FES (Homo sapiens) 6480464 pentanal results in increased expression of FES mRNA CTD PMID:26079696 Fes Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Fes (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of FES mRNA CTD PMID:36331819 Fes Rat pirinixic acid multiple interactions ISO Fes (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of FES mRNA CTD PMID:19710929 Fes Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of FES mRNA CTD PMID:25905778 Fes Rat sodium arsenite increases expression ISO FES (Homo sapiens) 6480464 sodium arsenite results in increased expression of FES mRNA CTD PMID:34032870 Fes Rat tamibarotene affects expression ISO FES (Homo sapiens) 6480464 tamibarotene affects the expression of FES mRNA CTD PMID:15498508 Fes Rat testosterone decreases expression ISO FES (Homo sapiens) 6480464 Testosterone results in decreased expression of FES mRNA CTD PMID:33359661 Fes Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of FES mRNA CTD PMID:34492290 Fes Rat tocopherol increases expression ISO Fes (Mus musculus) 6480464 Tocopherols results in increased expression of FES mRNA CTD PMID:17056531 Fes Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of FES mRNA CTD PMID:33387578 Fes Rat triphenyl phosphate affects expression ISO FES (Homo sapiens) 6480464 triphenyl phosphate affects the expression of FES mRNA CTD PMID:37042841 Fes Rat tungsten decreases expression ISO Fes (Mus musculus) 6480464 Tungsten results in decreased expression of FES mRNA CTD PMID:30912803 Fes Rat urethane decreases expression ISO FES (Homo sapiens) 6480464 Urethane results in decreased expression of FES mRNA CTD PMID:28818685 Fes Rat valproic acid increases methylation ISO FES (Homo sapiens) 6480464 Valproic Acid results in increased methylation of FES gene CTD PMID:29154799 Fes Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of FES mRNA CTD PMID:33150595 Fes Rat valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of FES promoter CTD PMID:33150595 Fes Rat valproic acid increases expression ISO FES (Homo sapiens) 6480464 Valproic Acid results in increased expression of FES mRNA CTD PMID:28001369
Imported Annotations - PID (archival)
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) C60 fullerene (EXP) caffeine (ISO) carbon nanotube (ISO) cisplatin (ISO) Cuprizon (EXP) cyclosporin A (ISO) DDE (ISO) dexamethasone (ISO) fenvalerate (EXP) folic acid (ISO) furan (EXP) gamma-tocopherol (ISO) indometacin (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) ozone (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) resveratrol (EXP) sodium arsenite (ISO) tamibarotene (ISO) testosterone (ISO) thioacetamide (EXP) tocopherol (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) tungsten (ISO) urethane (ISO) valproic acid (EXP,ISO)
Biological Process
cardiac muscle cell proliferation (IEP) cell adhesion (IBA) cellular response to vitamin D (IEA,ISO) centrosome cycle (IEA,ISO) chemotaxis (IBA) microtubule bundle formation (IEA,ISO) myoblast proliferation (IEP) peptidyl-tyrosine phosphorylation (ISO) positive regulation of microtubule polymerization (IEA,ISO) positive regulation of monocyte differentiation (IEA,ISO) positive regulation of myeloid cell differentiation (IEA,ISO) positive regulation of neuron projection development (IEA,ISO) protein autophosphorylation (ISO) regulation of cell adhesion (IEA,ISO) regulation of cell differentiation (IEA,ISO) regulation of cell motility (IEA,ISO) regulation of cell population proliferation (IEA,ISO) regulation of cell shape (IEA,ISO) regulation of mast cell degranulation (IEA,ISO)
1.
Proto-oncogene expression in proliferating and differentiating cardiac and skeletal muscle.
Claycomb WC and Lanson NA, Biochem J. 1987 Nov 1;247(3):701-6. doi: 10.1042/bj2470701.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Identification of FES as a Novel Radiosensitizing Target in Human Cancers.
Kim BH, etal., Clin Cancer Res. 2020 Jan 1;26(1):265-273. doi: 10.1158/1078-0432.CCR-19-0610. Epub 2019 Oct 1.
4.
Prognostic CpG methylation biomarkers identified by methylation array in esophageal squamous cell carcinoma patients.
Kuo IY, etal., Int J Med Sci. 2014 May 30;11(8):779-87. doi: 10.7150/ijms.7405. eCollection 2014.
5.
Differential expression of protooncogenes related to transformation and cancer progression in rat myoblasts.
Leibovitch SA, etal., Cancer Res. 1986 Aug;46(8):4097-103.
6.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
An identity crisis for fps/fes: oncogene or tumor suppressor?
Sangrar W, etal., Cancer Res. 2005 May 1;65(9):3518-22. doi: 10.1158/0008-5472.CAN-04-3468.
10.
Epigenomic profiling of DNA methylation for hepatocellular carcinoma diagnosis and prognosis prediction.
Zhang C, etal., J Gastroenterol Hepatol. 2019 Oct;34(10):1869-1877. doi: 10.1111/jgh.14694. Epub 2019 Jun 20.
Fes Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 143,746,945 - 143,756,181 (-) NCBI GRCr8 mRatBN7.2 1 134,337,698 - 134,346,934 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 134,337,698 - 134,346,934 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 142,246,565 - 142,255,805 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 149,415,959 - 149,425,199 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 142,333,966 - 142,343,206 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 142,174,648 - 142,183,884 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 142,174,648 - 142,183,884 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 143,127,277 - 143,136,513 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 136,199,523 - 136,208,759 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 126,397,304 - 126,406,534 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
FES Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 90,884,504 - 90,895,776 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 90,883,695 - 90,895,776 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 91,427,734 - 91,439,006 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 89,228,713 - 89,240,010 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 89,228,712 - 89,240,010 NCBI Celera 15 67,836,636 - 67,847,969 (+) NCBI Celera Cytogenetic Map 15 q26.1 NCBI HuRef 15 67,539,170 - 67,550,515 (+) NCBI HuRef CHM1_1 15 91,269,239 - 91,280,594 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 88,643,915 - 88,655,365 (+) NCBI T2T-CHM13v2.0
Fes Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 80,027,506 - 80,037,702 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 80,027,504 - 80,037,694 (-) Ensembl GRCm39 Ensembl GRCm38 7 80,377,758 - 80,387,954 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 80,377,756 - 80,387,946 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 87,522,644 - 87,532,832 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 80,251,286 - 80,260,905 (-) NCBI MGSCv36 mm8 Celera 7 77,777,722 - 77,787,907 (-) NCBI Celera Cytogenetic Map 7 D2 NCBI cM Map 7 45.65 NCBI
Fes Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 14,948,123 - 14,960,005 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 14,948,121 - 14,959,035 (+) NCBI ChiLan1.0 ChiLan1.0
FES Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 80,437,700 - 80,449,677 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 84,135,731 - 84,147,865 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 69,576,936 - 69,588,834 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 88,774,967 - 88,786,965 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 88,774,965 - 88,786,965 (+) Ensembl panpan1.1 panPan2
FES Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 53,346,975 - 53,356,547 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 53,347,012 - 53,356,516 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 55,984,668 - 55,994,302 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 53,763,060 - 53,772,711 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 53,763,067 - 53,772,745 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 53,282,201 - 53,291,832 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 53,493,421 - 53,503,070 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 53,833,898 - 53,843,534 (-) NCBI UU_Cfam_GSD_1.0
Fes Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 130,199,476 - 130,210,580 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936483 16,123,779 - 16,135,044 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936483 16,123,938 - 16,135,044 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FES Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 53,472,947 - 53,485,082 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 53,472,947 - 53,485,084 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 58,504,744 - 58,516,272 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FES Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 8,967,542 - 8,979,475 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 8,965,997 - 8,979,361 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 37,746,110 - 37,758,650 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fes
.
Predicted Target Of
Count of predictions: 172 Count of miRNA genes: 133 Interacting mature miRNAs: 146 Transcripts: ENSRNOT00000016032 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 631570 Bp94 Blood pressure QTL 94 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123479780 142990467 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631202 Gluco13 Glucose level QTL 13 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 131763437 159756369 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
RH132075
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 134,337,740 - 134,337,924 (+) MAPPER mRatBN7.2 Rnor_6.0 1 142,174,691 - 142,174,874 NCBI Rnor6.0 Rnor_5.0 1 143,127,320 - 143,127,503 UniSTS Rnor5.0 RGSC_v3.4 1 136,199,566 - 136,199,749 UniSTS RGSC3.4 Celera 1 126,397,347 - 126,397,530 UniSTS RH 3.4 Map 1 1070.8 UniSTS Cytogenetic Map 1 q31 UniSTS
D1Bda27
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 134,348,264 - 134,348,555 (+) MAPPER mRatBN7.2 Rnor_6.0 1 142,185,215 - 142,185,505 NCBI Rnor6.0 Rnor_5.0 1 143,137,844 - 143,138,134 UniSTS Rnor5.0 RGSC_v3.4 1 136,210,090 - 136,210,380 UniSTS RGSC3.4 Celera 1 126,407,865 - 126,408,155 UniSTS Cytogenetic Map 1 q31 UniSTS
RH94589
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 134,348,147 - 134,348,343 (+) MAPPER mRatBN7.2 Rnor_6.0 1 142,185,098 - 142,185,293 NCBI Rnor6.0 Rnor_5.0 1 143,137,727 - 143,137,922 UniSTS Rnor5.0 RGSC_v3.4 1 136,209,973 - 136,210,168 UniSTS RGSC3.4 Celera 1 126,407,748 - 126,407,943 UniSTS RH 3.4 Map 1 1074.0 UniSTS Cytogenetic Map 1 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016032 ⟹ ENSRNOP00000016032
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 134,337,698 - 134,346,934 (-) Ensembl Rnor_6.0 Ensembl 1 142,174,648 - 142,183,884 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114248 ⟹ ENSRNOP00000082184
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 134,337,703 - 134,346,934 (-) Ensembl
RefSeq Acc Id:
NM_001108488 ⟹ NP_001101958
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 143,746,945 - 143,756,181 (-) NCBI mRatBN7.2 1 134,337,698 - 134,346,934 (-) NCBI Rnor_6.0 1 142,174,648 - 142,183,884 (-) NCBI Rnor_5.0 1 143,127,277 - 143,136,513 (-) NCBI RGSC_v3.4 1 136,199,523 - 136,208,759 (-) RGD Celera 1 126,397,304 - 126,406,534 (-) RGD
Sequence:
CCGCCCCGCGGCCTACAGCAACTGAAACCACGGAGGAGGAAGCAGGAATCAGGAACTGGCCGGGTAGATTCTGGGCTGTTAGTCGGTCCACTGCCACCTGTCCCAGGAGCAGCTGCCCAAGAAAGGAC
hide sequence
RefSeq Acc Id:
XM_039082331 ⟹ XP_038938259
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 143,750,825 - 143,755,550 (-) NCBI mRatBN7.2 1 134,341,588 - 134,346,850 (-) NCBI
RefSeq Acc Id:
XM_063266933 ⟹ XP_063123003
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 143,749,848 - 143,755,550 (-) NCBI
RefSeq Acc Id:
XM_063266941 ⟹ XP_063123011
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 143,751,286 - 143,755,550 (-) NCBI
RefSeq Acc Id:
XR_005488133
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 143,750,817 - 143,755,550 (-) NCBI mRatBN7.2 1 134,341,570 - 134,346,850 (-) NCBI
RefSeq Acc Id:
XR_005488136
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 143,750,855 - 143,755,550 (-) NCBI mRatBN7.2 1 134,341,623 - 134,346,850 (-) NCBI
RefSeq Acc Id:
XR_350521
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 143,747,548 - 143,755,550 (-) NCBI mRatBN7.2 1 134,337,698 - 134,346,850 (-) NCBI Rnor_6.0 1 142,174,648 - 142,183,866 (-) NCBI Rnor_5.0 1 143,127,277 - 143,136,513 (-) NCBI
Sequence:
CAACTGAAACCACGGAGGAGGAAGCAGGAATCAGGAACTGGCCGGGTAGATTCTGGGCTGTTAGTCGGTCCACTGCCACCTGTCCCAGGAGCAGCTGCCCAAGAAAGGACACCATTATGGGCTTCTCT
hide sequence
RefSeq Acc Id:
NP_001101958 ⟸ NM_001108488
- UniProtKB:
D4A584 (UniProtKB/TrEMBL), A6JCB2 (UniProtKB/TrEMBL), A0A8I5ZWJ2 (UniProtKB/TrEMBL)
- Sequence:
MGFSSELCSPQGHGAVQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSWSSGPDSPVSQSWAEITSQTENLSRVLRQHAEDLNSGPLSKLSVLIRERQHLRKTYNEQWQQLQQELT
hide sequence
Ensembl Acc Id:
ENSRNOP00000016032 ⟸ ENSRNOT00000016032
RefSeq Acc Id:
XP_038938259 ⟸ XM_039082331
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000082184 ⟸ ENSRNOT00000114248
RefSeq Acc Id:
XP_063123003 ⟸ XM_063266933
- Peptide Label:
isoform X1
- UniProtKB:
A6JCB7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063123011 ⟸ XM_063266941
- Peptide Label:
isoform X3
- UniProtKB:
B2GV16 (UniProtKB/TrEMBL)
RGD ID: 13690146 Promoter ID: EPDNEW_R670 Type: initiation region Name: Fes_1 Description: FES proto-oncogene, tyrosine kinase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 142,183,819 - 142,183,879 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-07-09
Fes
FES proto-oncogene, tyrosine kinase
Fes
feline sarcoma oncogene
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-06
Fes
feline sarcoma oncogene
RGD1564385_predicted
similar to tyrosine kinase Fps/Fes (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1564385_predicted
similar to tyrosine kinase Fps/Fes (predicted)
LOC361597
similar to tyrosine kinase Fps/Fes
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC361597
similar to tyrosine kinase Fps/Fes
Symbol and Name status set to provisional
70820 PROVISIONAL
