Advanced Search (OLGA)

Gene: Prkra (protein activator of interferon induced protein kinase EIF2AK2) Rattus norvegicus

Analyze

Symbol:

Prkra

Name:

protein activator of interferon induced protein kinase EIF2AK2

RGD ID:

1306707

Description:

Enables protein kinase binding activity. Involved in positive regulation of cell population proliferation. Predicted to be located in perinuclear region of cytoplasm. Predicted to be part of RISC complex and RISC-loading complex. Predicted to be active in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in dystonia 16. Orthologous to human PRKRA (protein activator of interferon induced protein kinase EIF2AK2); PARTICIPATES IN ceramide signaling pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

interferon-inducible double stranded RNA-dependent protein kinase activator A; interferon-inducible double-stranded RNA-dependent protein kinase activator A; LOC311130; PKR associated protein X; protein activator of the interferon-induced protein kinase; protein kinase, interferon inducible double stranded RNA dependent activator; protein kinase, interferon-inducible double stranded RNA-dependent activator; protein kinase, interferon-inducible double-stranded RNA-dependent activator; RAX

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	81,982,669 - 82,002,028 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	81,982,673 - 82,001,525 (-)	Ensembl				GRCr8
mRatBN7.2	3	61,575,447 - 61,594,393 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	61,575,447 - 61,594,347 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	64,929,458 - 64,949,666 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	73,513,107 - 73,533,316 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	71,280,761 - 71,300,937 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	63,489,081 - 63,507,918 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	63,489,074 - 63,507,926 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	70,062,242 - 70,081,079 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	59,327,653 - 59,346,511 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	61,061,241 - 61,080,098 (-)	NCBI		Celera
RGSC_v3.1	3	59,224,026 - 59,242,883 (-)	NCBI
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Congenital Microtia (ISO)

Craniofacial Abnormalities (ISO)

dystonia (ISO)

dystonia 16 (ISO)

Experimental Diabetes Mellitus (IEP)

genetic disease (ISO)

Hearing Disorders (ISO)

intellectual disability (ISO)

Parkinsonism (ISO)

Rhinosinusitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Brodifacoum (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

dibutyl phthalate (EXP,ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

fipronil (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

ivermectin (ISO)

lead diacetate (ISO)

methimazole (EXP)

methoxychlor (EXP)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

SB 431542 (ISO)

scopolamine (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

theophylline (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antiviral innate immune response (IEA,ISO)

cellular response to oxidative stress (ISO)

ear development (ISO)

middle ear morphogenesis (ISO)

miRNA processing (IEA,ISO)

outer ear morphogenesis (ISO)

positive regulation of cell population proliferation (IMP)

positive regulation of intrinsic apoptotic signaling pathway (ISO)

pre-miRNA processing (IEA,ISO)

protein phosphorylation (ISO)

protein stabilization (IEA,ISO)

regulation of regulatory ncRNA processing (IBA)

regulatory ncRNA-mediated gene silencing (IEA)

RISC complex assembly (IEA,ISO)

siRNA processing (IBA,IEA,ISO,ISS)

skeletal system morphogenesis (ISO)

Cellular Component

cytoplasm (IBA,IEA,ISO,ISS)

cytosol (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA)

perinuclear region of cytoplasm (IEA)

RISC complex (IBA)

RISC-loading complex (IBA,IEA,ISO)

Molecular Function

double-stranded RNA binding (IBA,IEA,ISO)

enzyme activator activity (IEA,ISO)

enzyme binding (IEA,ISO)

identical protein binding (IEA,ISO)

pre-miRNA binding (IEA,ISO)

protein binding (ISO)

protein homodimerization activity (IEA,ISO)

protein kinase binding (IPI)

RNA binding (IEA)

siRNA binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

ceramide signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	The double-stranded RNA-binding protein, PACT, is required for postnatal anterior pituitary proliferation.	Peters GA, etal., Proc Natl Acad Sci U S A. 2009 Jun 30;106(26):10696-701. doi: 10.1073/pnas.0900735106. Epub 2009 Jun 17.
6.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Expression and cellular localization of microRNA-29b and RAX, an activator of the RNA-dependent protein kinase (PKR), in the retina of streptozotocin-induced diabetic rats.	Silva VA, etal., Mol Vis. 2011;17:2228-40. Epub 2011 Aug 18.
11.	Activation of double-stranded RNA-activated protein kinase by mild impairment of oxidative metabolism in neurons.	Wang X, etal., J Neurochem. 2007 Dec;103(6):2380-90. Epub 2007 Oct 22.
12.	Expression of microRNA machinery proteins in different types of chronic rhinosinusitis.	Zhang YN, etal., Laryngoscope. 2012 Dec;122(12):2621-7. doi: 10.1002/lary.23517. Epub 2012 Sep 7.

Additional References at PubMed

PMID:10336432	PMID:12181197	PMID:12477932	PMID:15489334	PMID:16169070	PMID:16396499	PMID:16424907	PMID:16571658	PMID:17452327	PMID:19946888	PMID:21900206	PMID:22681889
PMID:23661684	PMID:25416956	PMID:26234751	PMID:27987116	PMID:35421805

Genomics

Comparative Map Data

Prkra
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	81,982,669 - 82,002,028 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	81,982,673 - 82,001,525 (-)	Ensembl				GRCr8
mRatBN7.2	3	61,575,447 - 61,594,393 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	61,575,447 - 61,594,347 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	64,929,458 - 64,949,666 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	73,513,107 - 73,533,316 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	71,280,761 - 71,300,937 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	63,489,081 - 63,507,918 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	63,489,074 - 63,507,926 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	70,062,242 - 70,081,079 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	59,327,653 - 59,346,511 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	61,061,241 - 61,080,098 (-)	NCBI		Celera
RGSC_v3.1	3	59,224,026 - 59,242,883 (-)	NCBI
Cytogenetic Map	3	q24	NCBI

PRKRA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	178,431,414 - 178,451,175 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	178,431,292 - 178,451,512 (-)	Ensembl			hg38	GRCh38
GRCh37	2	179,296,141 - 179,315,902 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	179,004,395 - 179,024,110 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	179,121,656 - 179,141,371	NCBI
Celera	2	172,899,027 - 172,918,844 (-)	NCBI		Celera
Cytogenetic Map	2	q31.2	NCBI
HuRef	2	171,166,825 - 171,186,642 (-)	NCBI		HuRef
CHM1_1	2	179,302,152 - 179,321,965 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	178,914,206 - 178,933,968 (-)	NCBI		T2T-CHM13v2.0

Prkra
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	76,436,385 - 76,478,614 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	76,460,242 - 76,478,359 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	76,609,215 - 76,648,220 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	76,629,898 - 76,648,015 (-)	Ensembl			mm10	GRCm38
MGSCv37	2	76,467,994 - 76,486,051 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	76,430,776 - 76,448,833 (-)	NCBI		MGSCv36	mm8
Celera	2	78,291,609 - 78,309,670 (-)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	45.07	NCBI

Prkra
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	18,373,375 - 18,410,627 (+)	Ensembl
ChiLan1.0	NW_004955403	18,394,609 - 18,410,381 (+)	NCBI	ChiLan1.0	ChiLan1.0

PRKRA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	81,079,378 - 81,098,864 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	81,094,352 - 81,113,838 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	65,689,029 - 65,708,493 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	183,393,819 - 183,413,174 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	183,393,819 - 183,413,174 (-)	Ensembl			panPan2	panpan1.1

PRKRA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	22,061,226 - 22,080,324 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	22,061,461 - 22,080,612 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	22,079,633 - 22,098,744 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	22,204,685 - 22,224,038 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	22,204,686 - 22,224,130 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	22,314,310 - 22,333,404 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	22,276,900 - 22,296,069 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	22,393,174 - 22,412,535 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Prkra
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	139,099,289 - 139,115,053 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	7,653,047 - 7,668,896 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936509	7,653,192 - 7,668,925 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PRKRA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	84,133,687 - 84,156,508 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	84,134,273 - 84,156,596 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	93,668,054 - 93,690,407 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PRKRA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	63,982,784 - 64,003,919 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666040	135,571,753 - 135,592,072 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Prkra
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624844	410,461 - 424,809 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624844	410,461 - 424,833 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Prkra
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	53,977,526 - 53,997,153 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Prkra
127 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	53
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000015624
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	73592611	110333156	Rat
1358293	Bw38	Body weight QTL 38	6	0.0000031	body mass (VT:0001259)	body weight (CMO:0000012)	3	74364268	119364268	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	59863663	87321459	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	136118980	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	48876619	93876619	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	48876619	93876619	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	47904172	92904172	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	87321459	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	48657744	93657744	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	81425008	141509147	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	70845569	136091483	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	37796919	82796919	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	83358329	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	58925062	103925062	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	70311536	115311536	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	81541464	126563126	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	48657744	93657744	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	50766145	95766145	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	50766145	95766145	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	48657744	93657744	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
1582249	Bw77	Body weight QTL 77	3.2	0.0025	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	85062403	Rat
2325840	Bp345	Blood pressure QTL 345		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	83708931	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	48657744	93657744	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	37363734	82363734	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	48657744	93657744	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283635	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC097446	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015624 ⟹ ENSRNOP00000015624

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	81,982,673 - 82,001,525 (-)	Ensembl
mRatBN7.2 Ensembl	3	61,575,447 - 61,594,347 (-)	Ensembl
Rnor_6.0 Ensembl	3	63,489,074 - 63,507,926 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118415 ⟹ ENSRNOP00000085624

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	61,575,447 - 61,593,869 (-)	Ensembl

RefSeq Acc Id:

NM_001024780 ⟹ NP_001019951

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	81,982,669 - 82,001,525 (-)	NCBI
mRatBN7.2	3	61,575,447 - 61,594,303 (-)	NCBI
Rnor_6.0	3	63,489,081 - 63,507,918 (-)	NCBI
Rnor_5.0	3	70,062,242 - 70,081,079 (-)	NCBI
RGSC_v3.4	3	59,327,653 - 59,346,511 (-)	RGD
Celera	3	61,061,241 - 61,080,098 (-)	RGD

Sequence:

show sequence

GGCAGCGATCCGAGGGGCGTCCAAGCGGTAGCGCGGGCACGCTCCTCTCGGGAACTGGCCGACG
TGGAGAGGGAGGACCCAGATTCTCACTGCTCCGGATTGCTGTGGCCAGCCGTCCCTTCTCGCCA
TGTCCCACAGCAGGCATCGTGCCGAGGCCCCGCCGCTGCAGCGCGAGGACAGCGGGACCTTCAG
TTTGGGCAAGATGATAACAGCTAAGCCTGGGAAAACACCGATTCAGGTATTGCACGAGTACGGC
ACGAAGACCAAGAACATTCCAGTTTATGAATGTGAAAGATCCGATGTGCAAGTACACGTGCCCA
CTTTCACCTTCAGAGTAACCGTTGGTGACATAACTTGCACAGGTGAAGGGACGAGTAAGAAGCT
GGCGAAGCACAGAGCTGCAGAGGCTGCCATAAACATTTTGAAAGCCAATGCAAGTATTTGCTTT
GCAGTTCCTGACCCCTTAATGCCTGATCCATCCAAACAGCCAAAGAACCAGCTGAATCCAATTG
GCTCATTACAGGAATTAGCAATTCACCATGGCTGGCGGCTTCCTGAATATACCCTTTCCCAGGA
AGGAGGACCCGCTCATAAGAGAGAATATACCACGATTTGCAGGCTAGAGTCATTCATGGAAACT
GGAAAGGGGGCATCAAAAAAACAAGCAAAGAGAAACGCTGCTGAGAAATTCCTCGCCAAATTTA
GTAATATTTCTCCAGAGAACCACATTTCTCTAACGAATGTGGTCGGACATTCCCTGGGATGCAC
TTGGCACTCCTTGAGGAATTCCCCTGGTGAAAAGATCAACCTTCTGAAAAGGAGCCTCCTCAGT
CTGCCCAACACAGACTACATCCAGCTGCTCAGTGAGATAGCCAAAGAGCAAGGCTTCAGTATAA
CATACTTGGATATAGAGGAGCTGAGTGCCAACGGGCAGTATCAGTGTCTCGCAGAGCTGTCCAC
CAGTCCCATCACCGTGTGTCATGGCTCAGGCATCTCCTGTGGCAATGCCCAGAGTGACGCCGCT
CACAATGCCCTGCAGTATCTAAAGATAATAGCAGAAAGAAAGTAGGCTCGGAGCAAGTGAGTCT
TTCCAAAGCGCAAAGAAGTTTCCCTCGCACCTCTTCCCAGTAAAACATTTACCGTAATGTACGT
CTGCGTGTCCTTTCCAAATCCTCTTCGGATTCCCTCAACTTCCCAGATTTAATCGTCTCCTGGT
AGTTGTTATTAAGCTCTTTTTAATGGCTTCAACTTTGTATTGGTATATTGTGTTTATAAACTTT
GTACCACAAGGCTGAGTGTGGCATCCATTTTACAGGGTCAGACACATAGGTTGAACCTGCATGT
TTGACTGTAACAGTGAAGGGATAAGAGCACTGCTAACAACAGTCTTACTGGTGCTTAAACTGTT
CTGTGCAAAGCTTTGTGAAGTGGATTCTGAAGAGCCCTTTTAGACTAGAGCGTTGAGGCTTGTG
ATGAATGTCATTGCTAAATTTCAGGGAACATGGTCGGTTTGCTATGTATTTGAAACCATGGAAT
AAAAAGCTGTTCTTATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039104859 ⟹ XP_038960787

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	81,982,669 - 82,001,427 (-)	NCBI
mRatBN7.2	3	61,575,447 - 61,594,393 (-)	NCBI

RefSeq Acc Id:

XM_063283635 ⟹ XP_063139705

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	81,997,110 - 82,002,028 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001019951	(Get FASTA)	NCBI Sequence Viewer
	XP_038960787	(Get FASTA)	NCBI Sequence Viewer
	XP_063139705	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97446	(Get FASTA)	NCBI Sequence Viewer
	EDL79229	(Get FASTA)	NCBI Sequence Viewer
	EDL79230	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015624
GenBank Protein	Q4V8C7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001019951 ⟸ NM_001024780

- UniProtKB:

Q4V8C7 (UniProtKB/Swiss-Prot), A0A8I6A497 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSHSRHRAEAPPLQREDSGTFSLGKMITAKPGKTPIQVLHEYGTKTKNIPVYECERSDVQVHVP
TFTFRVTVGDITCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPI
GSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKF
SNISPENHISLTNVVGHSLGCTWHSLRNSPGEKINLLKRSLLSLPNTDYIQLLSEIAKEQGFSI
TYLDIEELSANGQYQCLAELSTSPITVCHGSGISCGNAQSDAAHNALQYLKIIAERK

hide sequence

Ensembl Acc Id:

ENSRNOP00000015624 ⟸ ENSRNOT00000015624

RefSeq Acc Id:	XP_038960787 ⟸ XM_039104859
- Peptide Label:	isoform X1
- UniProtKB:	A6HMH9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000085624 ⟸ ENSRNOT00000118415

RefSeq Acc Id:	XP_063139705 ⟸ XM_063283635
- Peptide Label:	isoform X2

Protein Domains

DRBM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4V8C7-F1-model_v2	AlphaFold	Q4V8C7	1-313	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692159

Promoter ID:

EPDNEW_R2684

Type:

initiation region

Name:

Prkra_1

Description:

protein activator of interferon induced protein kinase EIF2AK2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	63,507,948 - 63,508,008	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306707	AgrOrtholog
BioCyc Gene	G2FUF-49279	BioCyc
Ensembl Genes	ENSRNOG00000011195	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000015624	ENTREZGENE
Gene3D-CATH	3.30.160.20	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7456528	IMAGE-MGC_LOAD
InterPro	dsRBD_dom	UniProtKB/Swiss-Prot
	PRKRA_DSRM_1	UniProtKB/Swiss-Prot
	PRKRA_DSRM_2	UniProtKB/Swiss-Prot
	PRKRA_DSRM_3	UniProtKB/Swiss-Prot
	RLC_Component	UniProtKB/Swiss-Prot
KEGG Report	rno:311130	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114506	IMAGE-MGC_LOAD
NCBI Gene	311130	ENTREZGENE
PANTHER	LOQUACIOUS, ISOFORM B	UniProtKB/Swiss-Prot
	PTHR46205:SF2	UniProtKB/Swiss-Prot
Pfam	dsrm	UniProtKB/Swiss-Prot
PhenoGen	Prkra	PhenoGen
PROSITE	DS_RBD	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011195	RatGTEx
SMART	DSRM	UniProtKB/Swiss-Prot
Superfamily-SCOP	dsRNA-binding domain-like	UniProtKB/Swiss-Prot
UniProt	A0A8I6A497	ENTREZGENE
	A6HMH8_RAT	UniProtKB/TrEMBL
	A6HMH9	ENTREZGENE, UniProtKB/TrEMBL
	G3V7J2_RAT	UniProtKB/TrEMBL
	PRKRA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-13	Prkra	protein activator of interferon induced protein kinase EIF2AK2	Prkra	protein kinase, interferon inducible double stranded RNA dependent activator	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Prkra	protein kinase, interferon inducible double stranded RNA dependent activator	Prkra_predicted	protein kinase, interferon inducible double stranded RNA dependent activator (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Prkra_predicted	protein kinase, interferon inducible double stranded RNA dependent activator (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)