Advanced Search (OLGA)

Gene: Adora3 (adenosine A3 receptor) Rattus norvegicus

Analyze

Symbol:

Adora3

Name:

adenosine A3 receptor

RGD ID:

2051

Description:

Enables G protein-coupled adenosine receptor activity. Involved in G protein-coupled receptor signaling pathway; presynaptic modulation of chemical synaptic transmission; and regulation of norepinephrine secretion. Located in presynaptic membrane. Is active in Schaffer collateral - CA1 synapse. Orthologous to human ADORA3 (adenosine A3 receptor); INTERACTS WITH 2,4-dinitrobenzenesulfonic acid; 3-iodobenzyl-5'-N-methylcarboxamidoadenosine; acrylamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

A3; Adenosine receptor A3; adenosine receptor A3-like; LOC100911796; putative G-protein coupled receptor; TGPCR1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ADORA3 (adenosine A3 receptor)	RGD	RGD
Mus musculus (house mouse):	Adora3 (adenosine A3 receptor)	RGD	RGD
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100980598 (adenosine receptor A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ADORA3 (adenosine A3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101973578 (adenosine receptor A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ADORA3 (adenosine A3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ADORA3 (adenosine A3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Adora3 (adenosine A3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Adora3 (adenosine A3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TMIGD3 (transmembrane and immunoglobulin domain containing 3)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Adora3 (adenosine A3 receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ADORA3 (adenosine A3 receptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ADORA3 (adenosine A3 receptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	adora4a (adenosine A4 receptor a)	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	AdoR	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ador-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	ador-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	adora3.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	adora3.2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	adora3.1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	adora3.1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	adora3.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	196,077,042 - 196,080,686 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	196,077,042 - 196,080,686 (+)	Ensembl				GRCr8
mRatBN7.2	2	193,352,759 - 193,392,946 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	193,388,713 - 193,392,357 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	200,983,156 - 200,986,800 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	198,878,989 - 198,882,630 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	193,695,946 - 193,699,587 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	208,492,231 - 208,536,910 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,530,864 - 208,534,506 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,373,154 - 208,376,803 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	227,900,059 - 227,955,985 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	2	227,743,778 - 227,796,705 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	201,157,782 - 201,161,425 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	186,090,081 - 186,093,723 (+)	NCBI		Celera
RGSC_v3.1	2	201,120,535 - 201,124,179 (+)	NCBI
RH 3.4 Map	2	1369.2	RGD
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

Experimental Liver Cirrhosis (ISO)

ischemia (ISO)

myocardial infarction (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrobenzenesulfonic acid (EXP)

3-iodobenzyl-5'-N-methylcarboxamidoadenosine (EXP,ISO)

3-methylcholanthrene (ISO)

acetylsalicylic acid (ISO)

acrylamide (EXP)

adenosine (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

amphotericin B (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (EXP)

dextran sulfate (ISO)

dichlorine (EXP)

diethyl maleate (EXP)

dipyridamole (EXP)

disodium cromoglycate (EXP)

dizocilpine maleate (ISO)

graphite (EXP)

indometacin (ISO)

lipopolysaccharide (ISO)

medroxyprogesterone acetate (ISO)

methamphetamine (EXP,ISO)

methotrexate (EXP,ISO)

N-ethyl-5'-carboxamidoadenosine (ISO)

ozone (EXP,ISO)

phenobarbital (EXP)

phenylephrine (EXP)

phorbol 13-acetate 12-myristate (ISO)

prazosin (EXP)

Ptaquiloside (ISO)

pyrazoles (ISO)

quinolines (ISO)

resveratrol (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

scopolamine (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium dichromate (ISO)

sulforaphane (ISO)

tamibarotene (ISO)

tetrachloromethane (ISO)

titanium dioxide (EXP,ISO)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (IEA,ISO,ISS)

G protein-coupled adenosine receptor signaling pathway (IBA,IEA,ISO)

G protein-coupled receptor signaling pathway (IDA,IEA)

histamine secretion by mast cell (ISO)

negative regulation of cell migration (IEA,ISO)

negative regulation of cell population proliferation (IEA,ISO)

positive regulation of calcium-mediated signaling (ISO)

positive regulation of inflammatory response (ISO)

positive regulation of leukocyte migration (ISO)

positive regulation of mast cell degranulation (IMP,ISO)

positive regulation of mucus secretion (ISO)

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO)

presynaptic modulation of chemical synaptic transmission (EXP,IDA)

regulation of amine transport (IEA)

regulation of cell communication (IEA)

regulation of heart contraction (IEA,ISO)

regulation of norepinephrine secretion (IMP)

regulation of secretion by cell (IEA)

regulation of signaling (IEA)

signal transduction (IEA)

Cellular Component

dendrite (IBA)

membrane (IEA)

neuromuscular junction (ISO)

plasma membrane (IBA,IEA,ISO)

presynaptic membrane (IDA)

Schaffer collateral - CA1 synapse (EXP,IDA)

synapse (IBA,ISO)

Molecular Function

G protein-coupled adenosine receptor activity (IBA,IDA,IEA,ISO)

G protein-coupled receptor activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	[Drug therapy of shock].	Bartels O, etal., Fortschr Med. 1978 Mar 30;96(12):653-60.
2.	The role of adenosine A2A and A3 receptors on the differential modulation of norepinephrine and neuropeptide Y release from peripheral sympathetic nerve terminals.	Donoso MV, etal., J Neurochem. 2006 Mar;96(6):1680-95.
3.	Activation of hippocampal adenosine A3 receptors produces a desensitization of A1 receptor-mediated responses in rat hippocampus.	Dunwiddie TV, etal., J Neurosci. 1997 Jan 15;17(2):607-14.
4.	Subtype-specific regulation of receptor internalization and recycling by the carboxyl-terminal domains of the human A1 and rat A3 adenosine receptors: consequences for agonist-stimulated translocation of arrestin3.	Ferguson G, etal., Biochemistry 2002 Dec 17;41(50):14748-61.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
8.	Adenosine A3 receptors are located in neurons of the rat hippocampus.	Lopes LV, etal., Neuroreport. 2003 Aug 26;14(12):1645-8.
9.	Adenosine A(3) receptor activation protects the myocardium from reperfusion/reoxygenation injury.	Maddock HL, etal., Am J Physiol Heart Circ Physiol 2002 Oct;283(4):H1307-13.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	N6-methyladenosine (m6A) is an endogenous A3 adenosine receptor ligand.	Ogawa A, etal., Mol Cell. 2021 Feb 18;81(4):659-674.e7. doi: 10.1016/j.molcel.2020.12.038. Epub 2021 Jan 19.
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	A role for the A3 adenosine receptor in determining tissue levels of cAMP and blood pressure: studies in knock-out mice.	Zhao Z, etal., Biochim Biophys Acta 2000 Mar 17;1500(3):280-90.
16.	Molecular cloning and characterization of an adenosine receptor: the A3 adenosine receptor.	Zhou QY, etal., Proc Natl Acad Sci U S A 1992 Aug 15;89(16):7432-6.

Additional References at PubMed

PMID:1647979	PMID:8612733	PMID:10660615	PMID:10692494	PMID:11214319	PMID:12477932	PMID:12817016	PMID:15240734	PMID:15632090	PMID:15681707	PMID:16943766	PMID:17519974
PMID:17626785	PMID:19740086	PMID:21335481	PMID:21849555	PMID:24311446	PMID:24352876	PMID:24754634	PMID:26297614	PMID:27886186	PMID:31556103	PMID:32461578	PMID:33007835
PMID:35775127

Genomics

Comparative Map Data

Adora3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	196,077,042 - 196,080,686 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	196,077,042 - 196,080,686 (+)	Ensembl				GRCr8
mRatBN7.2	2	193,352,759 - 193,392,946 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	193,388,713 - 193,392,357 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	200,983,156 - 200,986,800 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	198,878,989 - 198,882,630 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	193,695,946 - 193,699,587 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	208,492,231 - 208,536,910 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,530,864 - 208,534,506 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,373,154 - 208,376,803 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	227,900,059 - 227,955,985 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	2	227,743,778 - 227,796,705 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	201,157,782 - 201,161,425 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	186,090,081 - 186,093,723 (+)	NCBI		Celera
RGSC_v3.1	2	201,120,535 - 201,124,179 (+)	NCBI
RH 3.4 Map	2	1369.2	RGD
Cytogenetic Map	2	q34	NCBI

ADORA3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	111,499,429 - 111,503,633 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	111,499,429 - 111,503,633 (-)	Ensembl			hg38	GRCh38
GRCh37	1	112,042,051 - 112,046,255 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	111,827,493 - 111,908,120 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	111,754,096 - 111,758,785	NCBI
Celera	1	110,272,892 - 110,353,227 (-)	NCBI		Celera
Cytogenetic Map	1	p13.2	NCBI
HuRef	1	109,897,418 - 109,977,884 (-)	NCBI		HuRef
CHM1_1	1	112,140,977 - 112,221,562 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	111,514,110 - 111,518,318 (-)	NCBI		T2T-CHM13v2.0

Adora3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	105,811,737 - 105,816,244 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	105,778,174 - 105,816,242 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	105,904,421 - 105,908,928 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	105,870,858 - 105,908,926 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	105,673,776 - 105,726,960 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	106,032,542 - 106,036,410 (+)	NCBI		MGSCv36	mm8
Celera	3	108,059,748 - 108,112,932 (+)	NCBI		Celera
Cytogenetic Map	3	F2.2	NCBI
cM Map	3	46.45	NCBI

LOC100980598
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	115,463,745 - 115,547,180 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	114,611,926 - 114,693,342 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	114,144,642 - 114,225,407 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	126,122,352 - 126,202,396 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	126,122,352 - 126,202,396 (+)	Ensembl			panPan2	panpan1.1

ADORA3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	63,895,408 - 63,898,666 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	63,895,408 - 63,898,666 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	63,408,938 - 63,412,242 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	65,066,829 - 65,070,166 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	65,066,642 - 65,071,049 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	63,801,857 - 63,805,119 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	63,860,662 - 63,863,924 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	64,658,761 - 64,662,034 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

LOC101973578
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	17,309,039 - 17,325,264 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936690	152,777 - 168,411 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADORA3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	108,854,357 - 108,873,925 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	108,854,300 - 108,857,769 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	119,036,224 - 119,039,693 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADORA3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	22,043,367 - 22,127,103 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	22,106,190 - 22,123,629 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	36,352,015 - 36,375,319 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Adora3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	7,229,093 - 7,232,837 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624772	7,189,381 - 7,232,919 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Adora3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	52,212,669 - 52,216,003 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Adora3
13 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	201
Count of miRNA genes:	137
Interacting mature miRNAs:	152
Transcripts:	ENSRNOT00000021236, ENSRNOT00000050538
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	163997722	225110681	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	169358774	214358774	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149957381	221199885	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	138595962	205135428	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	124537199	209621565	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	145807215	220931416	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	154723085	199723085	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	154723085	199723085	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	154723085	199723085	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	205135267	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	154723085	199723085	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170652929	215652929	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	220931218	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	171994826	205135428	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	188565047	233565047	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	192287802	229609668	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	154723085	199723085	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	184856304	229856304	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	184856304	229856304	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	144882354	205135428	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
1357991	Ael2	Aortic elastin QTL 2	4.2	0.000071	aorta elastin amount (VT:0003905)	aortic elastin	2	169227906	214227906	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	192287802	221089121	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	184856304	229856304	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	192287802	237287802	Rat
1578671	Bmd10	Bone mineral density QTL 10	5.4		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	175931416	220931416	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	182024327	227024327	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	159440760	228950743	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	184482291	229482291	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	143746578	205135428	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	145306936	212705578	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	186850607	231850607	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	192287802	237287802	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	223841096	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	117415288	205135428	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	182635347	227635347	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	175008837	220008837	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	184856304	229856304	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	165453811	210453811	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	163253030	208253030	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166372086	229820014	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat

Markers in Region

ADORA3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	193,391,343 - 193,391,754 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	208,533,494 - 208,533,904	NCBI	Rnor6.0
Rnor_6.0	2	208,375,791 - 208,376,201	NCBI	Rnor6.0
Rnor_5.0	2	227,795,692 - 227,796,102	UniSTS	Rnor5.0
Rnor_5.0	2	227,954,972 - 227,955,382	UniSTS	Rnor5.0
RGSC_v3.4	2	201,160,413 - 201,160,823	UniSTS	RGSC3.4
Celera	2	186,092,710 - 186,093,120	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH94668

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	193,392,060 - 193,392,199 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	208,534,211 - 208,534,349	NCBI	Rnor6.0
Rnor_6.0	2	208,376,508 - 208,376,646	NCBI	Rnor6.0
Rnor_5.0	2	227,955,689 - 227,955,827	UniSTS	Rnor5.0
Rnor_5.0	2	227,796,409 - 227,796,547	UniSTS	Rnor5.0
RGSC_v3.4	2	201,161,130 - 201,161,268	UniSTS	RGSC3.4
Celera	2	186,093,427 - 186,093,565	UniSTS
RH 3.4 Map	2	1369.2	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	hemolymphoid system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	sensory system	visual system
6	1	12	41	42	86	61	8	43	19	33	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001302750	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001302751	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006233067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001836401	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001836419	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF102804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY011212	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR468632	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ075463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M94152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X59249	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X93219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021236 ⟹ ENSRNOP00000021236

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	196,077,042 - 196,080,686 (+)	Ensembl
mRatBN7.2 Ensembl	2	193,388,713 - 193,392,357 (+)	Ensembl

RefSeq Acc Id:

NM_001302750 ⟹ NP_001289679

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	196,077,042 - 196,080,686 (+)	NCBI
mRatBN7.2	2	193,388,713 - 193,392,357 (+)	NCBI

RefSeq Acc Id:

NM_001302751 ⟹ NP_001289680

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	196,077,042 - 196,080,686 (+)	NCBI
mRatBN7.2	2	193,388,713 - 193,392,357 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001289679	(Get FASTA)	NCBI Sequence Viewer
	NP_001289680	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40680	(Get FASTA)	NCBI Sequence Viewer
	AAC83925	(Get FASTA)	NCBI Sequence Viewer
	AAG35136	(Get FASTA)	NCBI Sequence Viewer
	AAY67748	(Get FASTA)	NCBI Sequence Viewer
	CAA41937	(Get FASTA)	NCBI Sequence Viewer
	CAA63702	(Get FASTA)	NCBI Sequence Viewer
	EDL81823	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021236
	ENSRNOP00000021236.3

RefSeq Acc Id:	NP_001289679 ⟸ NM_001302750
- Peptide Label:	isoform a
- UniProtKB:	Q4PKD9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALADIAVG VLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRLSFLVVNLP FSSPHSNRYRTVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVG LDYMVFFSFITWILIPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLF LFALCWLPLSIINFVSYFNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILRACR LCQTSDSLDSNLEQTTE hide sequence

RefSeq Acc Id:	NP_001289680 ⟸ NM_001302751
- Peptide Label:	isoform b
- UniProtKB:	Q63792 (UniProtKB/Swiss-Prot), P28647 (UniProtKB/Swiss-Prot), A6HUN6 (UniProtKB/TrEMBL), Q4PKD9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALADIAVG VLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRYRTVTTQRR IWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVGLDYMVFFSFITWILIPL VVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFLFALCWLPLSIINFVSY FNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILRACRLCQTSDSLDSNLEQTTE hide sequence

Ensembl Acc Id:

ENSRNOP00000021236 ⟸ ENSRNOT00000021236

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P28647-F1-model_v2	AlphaFold	P28647	1-320	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2051	AgrOrtholog
Ensembl Genes	ENSRNOG00000015788	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00000050743	Ensembl
Ensembl Transcript	ENSRNOT00000021236	ENTREZGENE
	ENSRNOT00000021236.4	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7453330	IMAGE-MGC_LOAD
InterPro	Adeno_A3_rcpt	UniProtKB/Swiss-Prot
	Adenosn_rcpt	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
KEGG Report	rno:100911796	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114438	IMAGE-MGC_LOAD
NCBI Gene	Adora3	ENTREZGENE
PANTHER	ADENOSINE RECEPTOR A3	UniProtKB/Swiss-Prot
	OLFACTORY RECEPTOR AND ADENOSINE RECEPTOR	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PharmGKB	ADORA3	RGD
PhenoGen	Adora3	PhenoGen
PRINTS	ADENOSINEA3R	UniProtKB/Swiss-Prot
	ADENOSINER	UniProtKB/Swiss-Prot
	GPCRRHODOPSN	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000015788	RatGTEx
	ENSRNOG00000050743	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A6HUN6	ENTREZGENE, UniProtKB/TrEMBL
	AA3R_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q4PKD9	ENTREZGENE, UniProtKB/TrEMBL
	Q63792	ENTREZGENE
	Q99P15_RAT	UniProtKB/TrEMBL
UniProt Secondary	Q63792	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-03-01	Adora3	adenosine A3 receptor	LOC100911796	adenosine receptor A3-like	Data merged from RGD:6491091	737654	PROVISIONAL
2012-07-05	LOC100911796	adenosine receptor A3-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-11-06	Adora3	adenosine A3 receptor		Adenosine receptor A3	Name updated	625702	APPROVED
2002-06-10	Adora3	Adenosine receptor A3			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains seven transmbembrane domain characteristic of G-protein coupled receptors	631810
gene_expression	expressed in brain	631810
gene_expression	mRNA expressed at high levels in testis	631810
gene_expression	mRNA detected in lung, kidney, heart, brain cortex, striatum, and olfactory bulb
gene_function	binds adenosine with a non-A1, non-A2 receptor specificity	631810
gene_process	may be involved in male reproduction	631810
gene_process	may play a role in remodeling after myocardial cell injury	631763
gene_product	member of the G-protein coupled receptor family	631810
gene_protein	protein sequence contains 320 amino acid residues	631810

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD