Advanced Search (OLGA)

Gene: Tomm7 (translocase of outer mitochondrial membrane 7) Rattus norvegicus

Analyze

Symbol:

Tomm7

Name:

translocase of outer mitochondrial membrane 7

RGD ID:

1591393

Description:

Predicted to be involved in positive regulation of protein targeting to mitochondrion; positive regulation of type 2 mitophagy; and regulation of protein stability. Predicted to be located in mitochondrion. Predicted to be part of mitochondrial outer membrane translocase complex. Orthologous to human TOMM7 (translocase of outer mitochondrial membrane 7); PARTICIPATES IN beta-barrel pathway of mitochondrial protein import; carrier pathway of mitochondrial protein import; mitochondrial autophagy pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC685620; mitochondrial import receptor subunit TOM7 homolog; similar to translocase of outer mitochondrial membrane 7 homolog; translocase of outer mitochondrial membrane 7 homolog; translocase of outer mitochondrial membrane 7 homolog (yeast)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	12,197,503 - 12,204,344 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	12,197,491 - 12,204,343 (+)	Ensembl				GRCr8
mRatBN7.2	4	11,305,122 - 11,311,963 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	11,305,110 - 11,311,962 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	16,456,675 - 16,463,543 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	12,281,753 - 12,288,658 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	10,628,651 - 10,635,519 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	7,835,949 - 7,842,790 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	7,835,949 - 7,842,789 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	7,844,007 - 7,850,848 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	6,675,775 - 6,682,616 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	6,919,104 - 6,925,945 (+)	NCBI		Celera
Cytogenetic Map	4	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

GARG-MISHRA PROGEROID SYNDROME (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

beauvericin (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

chloropicrin (ISO)

copper(II) sulfate (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

diuron (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

enniatin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenthion (ISO)

folic acid (ISO)

glafenine (EXP)

hydralazine (ISO)

isobutanol (ISO)

L-ascorbic acid (ISO)

lead(0) (ISO)

methidathion (ISO)

methimazole (EXP)

paracetamol (EXP)

PCB138 (ISO)

pirinixic acid (ISO)

resveratrol (ISO)

rotenone (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (EXP)

tolcapone (EXP)

triadimefon (EXP)

trichloroethene (EXP)

tungsten (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

obsolete positive regulation of protein targeting to mitochondrion (IBA,ISO)

positive regulation of type 2 mitophagy (ISO)

protein import into mitochondrial matrix (IEA)

protein transport (IEA)

regulation of protein stability (ISO)

Cellular Component

mitochondrial outer membrane (IEA)

mitochondrial outer membrane translocase complex (IBA,IEA,ISO)

mitochondrion (ISO)

Molecular Function

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

beta-barrel pathway of mitochondrial protein import (ISO)

carrier pathway of mitochondrial protein import (ISO)

mitochondrial autophagy pathway (ISO)

presequence pathway of mitochondrial protein import (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Biogenesis of mitochondrial outer membrane proteins, problems and diseases.	Ellenrieder L, etal., Biol Chem. 2015 Oct 1;396(11):1199-213. doi: 10.1515/hsz-2015-0170.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Assembly of beta-barrel proteins in the mitochondrial outer membrane.	Hohr AI, etal., Biochim Biophys Acta. 2015 Jan;1853(1):74-88. doi: 10.1016/j.bbamcr.2014.10.006. Epub 2014 Oct 8.
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation
7.	Unlocking the presequence import pathway.	Schulz C, etal., Trends Cell Biol. 2015 May;25(5):265-75. doi: 10.1016/j.tcb.2014.12.001. Epub 2014 Dec 23.
8.	Cooperation of protein machineries in mitochondrial protein sorting.	Wenz LS, etal., Biochim Biophys Acta. 2015 May;1853(5):1119-29. doi: 10.1016/j.bbamcr.2015.01.012. Epub 2015 Jan 26.
9.	Hypoxia activation of mitophagy and its role in disease pathogenesis.	Wu H and Chen Q, Antioxid Redox Signal. 2015 Apr 20;22(12):1032-46. doi: 10.1089/ars.2014.6204. Epub 2015 Feb 10.

Additional References at PubMed

PMID:12198123	PMID:12477932	PMID:18614015	PMID:24270810

Genomics

Comparative Map Data

Tomm7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	12,197,503 - 12,204,344 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	12,197,491 - 12,204,343 (+)	Ensembl				GRCr8
mRatBN7.2	4	11,305,122 - 11,311,963 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	11,305,110 - 11,311,962 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	16,456,675 - 16,463,543 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	12,281,753 - 12,288,658 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	10,628,651 - 10,635,519 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	7,835,949 - 7,842,790 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	7,835,949 - 7,842,789 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	7,844,007 - 7,850,848 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	6,675,775 - 6,682,616 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	6,919,104 - 6,925,945 (+)	NCBI		Celera
Cytogenetic Map	4	q11	NCBI

TOMM7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	22,812,974 - 22,822,849 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	22,812,628 - 22,822,849 (-)	Ensembl			hg38	GRCh38
GRCh37	7	22,852,593 - 22,862,468 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	22,818,776 - 22,828,946 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	22,625,493 - 22,635,661	NCBI
Celera	7	22,837,876 - 22,848,044 (-)	NCBI		Celera
Cytogenetic Map	7	p15.3	NCBI
HuRef	7	22,735,367 - 22,745,588 (-)	NCBI		HuRef
CHM1_1	7	22,853,157 - 22,863,376 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	22,948,907 - 22,958,779 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	22,903,376 - 22,913,595 (-)	NCBI

Tomm7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	24,043,942 - 24,049,143 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	24,043,942 - 24,049,159 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	23,838,944 - 23,844,145 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	23,838,944 - 23,844,161 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	23,344,762 - 23,349,963 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	23,349,719 - 23,354,172 (-)	NCBI		MGSCv36	mm8
Celera	5	20,790,590 - 20,795,798 (-)	NCBI		Celera
Cytogenetic Map	5	A3	NCBI
cM Map	5	10.48	NCBI

Tomm7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955410	25,157,860 - 25,166,898 (-)	Ensembl
ChiLan1.0	NW_004955410	25,157,860 - 25,166,898 (-)	NCBI	ChiLan1.0	ChiLan1.0

TOMM7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	27,679,302 - 27,689,182 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	76,004,028 - 76,013,912 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	23,501,438 - 23,511,321 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	23,112,630 - 23,122,195 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	23,112,630 - 23,122,195 (-)	Ensembl			panPan2	panpan1.1

TOMM7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	36,523,707 - 36,532,180 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	36,523,707 - 36,532,291 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	36,064,815 - 36,073,285 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	36,448,151 - 36,456,622 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	36,446,035 - 36,457,537 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	36,569,183 - 36,577,658 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	36,265,841 - 36,274,316 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	36,602,729 - 36,611,207 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tomm7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	80,819,056 - 80,825,218 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936478	30,666 - 37,062 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936478	30,787 - 36,952 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TOMM7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	91,570,065 - 91,579,015 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	91,570,069 - 91,578,991 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	100,959,712 - 100,968,629 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TOMM7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	35,485,860 - 35,496,281 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	35,485,685 - 35,497,325 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666042	69,090,185 - 69,100,606 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tomm7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624739	7,853,621 - 7,864,757 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624739	7,854,226 - 7,863,387 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tomm7
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	153,060,026 - 153,066,199 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tomm7
72 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	37
Count of miRNA genes:	37
Interacting mature miRNAs:	37
Transcripts:	ENSRNOT00000065962
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552903	Pigfal2	Plasma insulin-like growth factor 1 level QTL 2	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	1	32668025	Rat
724557	Plsm1	Polydactyly-luxate syndrome (PLS) morphotypes QTL 1		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	4	1	28392287	Rat
9590100	Sffal4	Serum free fatty acids level QTL 4	7.36	0.05	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	4	1	32668025	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	11038706	56038706	Rat
1357341	Gluco5	Glucose level QTL 5	6.4		adipocyte free fatty acid secretion trait (VT:0010465)	absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446)	4	1	34142783	Rat
1357343	Gluco4	Glucose level QTL 4		0.00002	adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	4	1	34142783	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	1	35396961	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	11038706	56038706	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5894575	57613242	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	11038706	56038706	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
61333	Gluco16	Glucose level QTL 16	4.3	0.00001	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	1	31106810	Rat
61408	Scl23	Serum cholesterol level QTL 23		0.0005	blood HDL phospholipid amount (VT:0010504)	serum high density lipoprotein phospholipid level (CMO:0001567)	4	1	28392287	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	1	45429897	Rat
8552803	Bw144	Body weight QTL 144	16		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	1	35396961	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	11038706	56038706	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	1	35396961	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
9589046	Scfw2	Subcutaneous fat weight QTL 2	5.54	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	4	1	32668025	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	11038706	56038706	Rat
61351	Bp33	Blood pressure QTL 33		0.0018	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	1	28392287	Rat
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	40471598	Rat
1641905	Colcr1	Colorectal carcinoma resistance QTL 1	4.3	0.0003	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	4	8428551	30449094	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5889999	50889999	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	1	35396961	Rat
738021	Hcar13	Hepatocarcinoma resistance QTL 13	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	4	1	33538816	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	1	63900697	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	11038706	56038706	Rat
9589097	Slep11	Serum leptin concentration QTL 11	5.09	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	4	1	32668025	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10758701	40490708	Rat

Markers in Region

RH130757

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	158,213,865 - 158,214,054 (+)	MAPPER	mRatBN7.2
mRatBN7.2	5	114,217,691 - 114,217,882 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	118,226,164 - 118,226,354	NCBI	Rnor6.0
Rnor_6.0	4	157,928,207 - 157,928,395	NCBI	Rnor6.0
Rnor_5.0	5	122,159,046 - 122,159,236	UniSTS	Rnor5.0
Rnor_5.0	4	224,944,351 - 224,944,539	UniSTS	Rnor5.0
RGSC_v3.4	4	162,236,996 - 162,237,184	UniSTS	RGSC3.4
RGSC_v3.4	5	120,178,965 - 120,179,155	UniSTS	RGSC3.4
Celera	5	112,766,643 - 112,766,833	UniSTS
Celera	4	146,949,747 - 146,949,935	UniSTS
Cytogenetic Map	4	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001135174	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166921	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB693792	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB698700	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221229	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223270	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000065962 ⟹ ENSRNOP00000060340

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	12,197,491 - 12,204,343 (+)	Ensembl
mRatBN7.2 Ensembl	4	11,305,110 - 11,311,962 (+)	Ensembl
Rnor_6.0 Ensembl	4	7,835,949 - 7,842,789 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098890 ⟹ ENSRNOP00000077515

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	11,305,110 - 11,311,961 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110323 ⟹ ENSRNOP00000091303

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	11,305,110 - 11,308,613 (+)	Ensembl

RefSeq Acc Id:

NM_001135174 ⟹ NP_001128646

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	12,197,503 - 12,204,344 (+)	NCBI
mRatBN7.2	4	11,305,122 - 11,311,963 (+)	NCBI
Rnor_6.0	4	7,835,949 - 7,842,790 (+)	NCBI
Rnor_5.0	4	7,844,007 - 7,850,848 (+)	NCBI
RGSC_v3.4	4	6,675,775 - 6,682,616 (+)	RGD
Celera	4	6,919,104 - 6,925,945 (+)	RGD

Sequence:

show sequence

CGACGCAGTCTTGGTTGTGGTGGCTCATCGTTCGGCTGGTCCGTCGTCGTCATGGTGAAGCTGA
GCAAGGAAGCCAAACAGAGGCTGCAGCAGCTCTTCAAGGGCGGCCAGTTTGCCATCCGCTGGGG
CTTTATTCCTCTCGTGATTTACCTGGGATTCACAAGGGGTGCAGATCCTGGAATGCCTGAACCA
TCAGTTTTAAGCCTACTTTGGGGATAAAGGACTGTTCGGTCATCTGGATCTGGACGCAGTGCAA
CATGGGAGGTGTGTGCTCCGGCTGGATGAGAAAGGAGACGTCATTTCAACACATCTGAGGCAGA
GTGGAGTCTGTACTGACTTACGATAGACTATCAAAATAAATATTTTTAACAATGTTAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001128646	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000060340
	ENSRNOP00000060340.1

RefSeq Acc Id:	NP_001128646 ⟸ NM_001135174
- UniProtKB:	D3ZMR1 (UniProtKB/TrEMBL), A0A8I5Y9K6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVKLSKEAKQRLQQLFKGGQFAIRWGFIPLVIYLGFTRGADPGMPEPSVLSLLWG hide sequence

Ensembl Acc Id:

ENSRNOP00000060340 ⟸ ENSRNOT00000065962

Ensembl Acc Id:

ENSRNOP00000077515 ⟸ ENSRNOT00000098890

Ensembl Acc Id:

ENSRNOP00000091303 ⟸ ENSRNOT00000110323

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZMR1-F1-model_v2	AlphaFold	D3ZMR1	1-55	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692799

Promoter ID:

EPDNEW_R3322

Type:

initiation region

Name:

Tomm7_1

Description:

translocase of outer mitochondrial membrane 7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	7,835,937 - 7,835,997	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1591393	AgrOrtholog
BioCyc Gene	G2FUF-46015	BioCyc
Ensembl Genes	ENSRNOG00000043114	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000065962	ENTREZGENE
	ENSRNOT00000065962.3	UniProtKB/TrEMBL
InterPro	Tom7	UniProtKB/TrEMBL
KEGG Report	rno:685620	UniProtKB/TrEMBL
NCBI Gene	685620	ENTREZGENE
PANTHER	MITOCHONDRIAL IMPORT RECEPTOR SUBUNIT TOM7 HOMOLOG	UniProtKB/TrEMBL
	MITOCHONDRIAL IMPORT RECEPTOR SUBUNIT TOM7 HOMOLOG	UniProtKB/TrEMBL
Pfam	Tom7	UniProtKB/TrEMBL
PhenoGen	Tomm7	PhenoGen
RatGTEx	ENSRNOG00000043114	RatGTEx
UniProt	A0A8I5Y9K6	ENTREZGENE
	D3ZMR1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-01	Tomm7	translocase of outer mitochondrial membrane 7	Tomm7	translocase of outer mitochondrial membrane 7 homolog (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Tomm7	translocase of outer mitochondrial membrane 7 homolog (yeast)	LOC685620	similar to translocase of outer mitochondrial membrane 7 homolog	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC685620	similar to translocase of outer mitochondrial membrane 7 homolog	LOC682454	similar to translocase of outer mitochondrial membrane 7 homolog	Data merged from RGD:1583438	1643240	APPROVED
2006-11-20	LOC685620	similar to translocase of outer mitochondrial membrane 7 homolog			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC682454	similar to translocase of outer mitochondrial membrane 7 homolog			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations