Cnn3 (calponin 3) - Rat Genome Database

Name: Cnn3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Cnn3 (calponin 3) Rattus norvegicus

Analyze

Symbol:

Cnn3

Name:

calponin 3

RGD ID:

71044

Description:

Enables microtubule binding activity. Predicted to be involved in actin filament organization and epithelial cell differentiation. Located in dendritic spine and neuronal cell body. Is active in glutamatergic synapse and postsynapse. Orthologous to human CNN3 (calponin 3); INTERACTS WITH (+)-pilocarpine; 17alpha-ethynylestradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

acidic calponin; acidic calponin h3; calponin 3, acidic; calponin, acidic isoform; calponin, non-muscle isoform; calponin-3

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CNN3 (calponin 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cnn3 (calponin 3, acidic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cnn3 (calponin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CNN3 (calponin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CNN3 (calponin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cnn3 (calponin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CNN3 (calponin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CNN3 (calponin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cnn3 (calponin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CNN3 (calponin 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Cnn3 (calponin 3, acidic)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cnn3a (calponin 3, acidic a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	cnn3b (calponin 3, acidic b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SCP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cpn-2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG5023	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cnn3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	212,203,661 - 212,234,772 (+)	NCBI		GRCr8
mRatBN7.2	2	209,518,948 - 209,550,107 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	209,518,948 - 209,550,104 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	217,181,924 - 217,213,028 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	215,089,643 - 215,120,749 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	209,931,377 - 209,962,475 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	225,005,069 - 225,036,179 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	225,005,019 - 225,036,188 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	243,044,080 - 243,075,234 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	218,044,803 - 218,075,914 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	218,007,864 - 218,038,976 (+)	NCBI
Celera	2	201,950,953 - 201,982,114 (+)	NCBI		Celera
Cytogenetic Map	2	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

carcinoma (ISO)

Experimental Mammary Neoplasms (ISO)

genetic disease (ISO)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (EXP)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

antimycin A (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Brodifacoum (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

captan (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

copper(II) sulfate (ISO)

CU-O LINKAGE (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

dibutyl phthalate (EXP,ISO)

dichlorine (EXP)

diethylstilbestrol (ISO)

diuron (EXP)

elemental selenium (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (ISO)

folic acid (ISO)

folpet (ISO)

gentamycin (EXP)

hyaluronic acid (EXP)

hydrogen peroxide (EXP)

indometacin (ISO)

iron atom (EXP)

iron(0) (EXP)

ivermectin (ISO)

leflunomide (EXP)

lipopolysaccharide (ISO)

N-nitrosodiethylamine (EXP)

ochratoxin A (ISO)

oxaliplatin (EXP)

ozone (EXP,ISO)

p-toluidine (EXP)

perfluorooctanoic acid (ISO)

phenobarbital (EXP)

PhIP (EXP)

pirinixic acid (ISO)

piroxicam (ISO)

rotenone (EXP,ISO)

selenium atom (ISO)

sodium dichromate (EXP,ISO)

Soman (EXP)

sulforaphane (ISO)

sunitinib (ISO)

tebufenpyrad (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

topotecan (EXP)

trichostatin A (ISO)

tunicamycin (ISO)

valproic acid (ISO)

zearalenone (ISO)

zinc atom (EXP)

zinc sulfate (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin filament organization (IBA,IEA)

actomyosin structure organization (IEA)

epithelial cell differentiation (ISO)

negative regulation of ATP-dependent activity (IDA)

Cellular Component

actin cytoskeleton (IBA,IEA,ISO)

actin filament (TAS)

cytosol (ISO)

dendrite (IDA)

dendritic spine (IDA)

focal adhesion (IEA)

glutamatergic synapse (IDA)

microtubule (TAS)

neuronal cell body (IDA)

postsynapse (IDA)

Molecular Function

actin binding (IEA)

actin filament binding (IBA,IEA)

calmodulin binding (IEA)

microtubule binding (IDA)

protein-macromolecule adaptor activity (NAS)

References

References - curated

#	Reference Title	Reference Citation
1.	Subcellular distribution of calponin and caldesmon in rat hippocampus.	Agassandian C, etal., Brain Res. 2000 Dec 29;887(2):444-9.
2.	Co-localization of caldesmon and calponin with cortical afferents, metabotropic glutamate and neurotrophic receptors in the lateral and central nuclei of the amygdala.	Agassandian K and Cassell MD, Brain Res. 2008 Aug 21;1226:39-55. Epub 2008 Jun 11.
3.	Cloning and expression of a novel acidic calponin isoform from rat aortic vascular smooth muscle.	Applegate D, etal., J Biol Chem 1994 Apr 8;269(14):10683-90.
4.	Mapping the microtubule binding regions of calponin.	Fattoum A, etal., Biochemistry 2003 Feb 11;42(5):1274-82.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Gene Data Set	MGD Curation, June 12, 2002
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	Distribution of caldesmon and of the acidic isoform of calponin in cultured cerebellar neurons and in different regions of the rat brain: an immunofluorescence and confocal microscopy study.	Represa A, etal., Exp Cell Res. 1995 Dec;221(2):333-43.
11.	GOA pipeline	RGD automated data pipeline
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:16358313	PMID:20181831	PMID:21423176	PMID:21492153	PMID:25468996

Genomics

Comparative Map Data

Cnn3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	212,203,661 - 212,234,772 (+)	NCBI		GRCr8
mRatBN7.2	2	209,518,948 - 209,550,107 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	209,518,948 - 209,550,104 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	217,181,924 - 217,213,028 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	215,089,643 - 215,120,749 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	209,931,377 - 209,962,475 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	225,005,069 - 225,036,179 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	225,005,019 - 225,036,188 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	243,044,080 - 243,075,234 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	218,044,803 - 218,075,914 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	218,007,864 - 218,038,976 (+)	NCBI
Celera	2	201,950,953 - 201,982,114 (+)	NCBI		Celera
Cytogenetic Map	2	q42	NCBI

CNN3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	94,896,957 - 94,927,110 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	94,896,949 - 94,927,223 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	95,362,513 - 95,392,666 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	95,135,095 - 95,165,289 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	95,074,529 - 95,104,722	NCBI
Celera	1	93,616,973 - 93,647,200 (-)	NCBI		Celera
Cytogenetic Map	1	p21.3	NCBI
HuRef	1	93,484,336 - 93,514,531 (-)	NCBI		HuRef
CHM1_1	1	95,477,311 - 95,507,534 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	94,745,314 - 94,775,463 (-)	NCBI		T2T-CHM13v2.0

Cnn3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	121,220,190 - 121,251,854 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	121,220,146 - 121,251,856 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	121,426,541 - 121,458,205 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	121,426,497 - 121,458,207 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	121,129,459 - 121,161,123 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	121,418,564 - 121,450,228 (+)	NCBI		MGSCv36	mm8
Celera	3	127,782,383 - 127,824,521 (+)	NCBI		Celera
Cytogenetic Map	3	G1	NCBI
cM Map	3	52.94	NCBI

Cnn3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955435	80,185 - 89,766 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955435	80,185 - 89,216 (-)	NCBI	ChiLan1.0	ChiLan1.0

CNN3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	132,096,906 - 132,127,207 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	131,251,606 - 131,281,812 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	97,558,652 - 97,588,791 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	96,286,015 - 96,316,249 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	96,286,015 - 96,316,249 (-)	Ensembl	panpan1.1		panPan2

CNN3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	54,378,031 - 54,405,009 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	54,368,162 - 54,404,201 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	57,077,741 - 57,105,796 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	54,751,458 - 54,778,564 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	54,743,775 - 54,778,564 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	54,425,310 - 54,453,361 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	54,409,986 - 54,438,043 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	54,862,633 - 54,890,718 (+)	NCBI		UU_Cfam_GSD_1.0

Cnn3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	104,609,983 - 104,638,951 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936537	4,308,951 - 4,337,998 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936537	4,308,951 - 4,337,990 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CNN3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	122,504,433 - 122,528,348 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	122,504,450 - 122,528,351 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	134,245,269 - 134,269,263 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CNN3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	38,325,810 - 38,356,563 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	38,325,848 - 38,356,760 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	79,710,142 - 79,740,641 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cnn3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	2,737,057 - 2,767,273 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624742	2,737,131 - 2,767,026 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cnn3
267 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	437
Count of miRNA genes:	233
Interacting mature miRNAs:	262
Transcripts:	ENSRNOT00000015579
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	185876309	219753474	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	185876309	219753474	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	189599258	218414891	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	189599258	226936289	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	190613715	226808892	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	199341726	234244620	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	200990457	245990457	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	202446871	237938339	Rat
2299161	Iddm33	Insulin dependent diabetes mellitus QTL 33	2.98		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	206312063	220876787	Rat
631203	Gluco14	Glucose level QTL 14		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	2	206665645	219003804	Rat

Markers in Region

RH128022

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	209,549,320 - 209,549,521 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	225,035,437 - 225,035,637	NCBI	Rnor6.0
Rnor_5.0	2	243,074,448 - 243,074,648	UniSTS	Rnor5.0
RGSC_v3.4	2	218,075,172 - 218,075,372	UniSTS	RGSC3.4
Celera	2	201,981,372 - 201,981,572	UniSTS
RH 3.4 Map	2	1501.4	UniSTS
Cytogenetic Map	2	q41	UniSTS

RH127599

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	209,549,845 - 209,550,031 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	225,035,962 - 225,036,147	NCBI	Rnor6.0
Rnor_5.0	2	243,074,973 - 243,075,158	UniSTS	Rnor5.0
RGSC_v3.4	2	218,075,697 - 218,075,882	UniSTS	RGSC3.4
Celera	2	201,981,897 - 201,982,082	UniSTS
RH 3.4 Map	2	1500.9	UniSTS
Cytogenetic Map	2	q41	UniSTS

RH129426

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	209,549,874 - 209,550,055 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	225,035,991 - 225,036,171	NCBI	Rnor6.0
Rnor_5.0	2	243,075,002 - 243,075,182	UniSTS	Rnor5.0
RGSC_v3.4	2	218,075,726 - 218,075,906	UniSTS	RGSC3.4
Celera	2	201,981,926 - 201,982,106	UniSTS
RH 3.4 Map	2	1518.7	UniSTS
Cytogenetic Map	2	q41	UniSTS

RH142485

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	209,527,968 - 209,528,142 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	225,014,087 - 225,014,260	NCBI	Rnor6.0
Rnor_5.0	2	243,053,098 - 243,053,271	UniSTS	Rnor5.0
RGSC_v3.4	2	218,053,822 - 218,053,995	UniSTS	RGSC3.4
Celera	2	201,960,073 - 201,960,246	UniSTS
RH 3.4 Map	2	1517.6	UniSTS
Cytogenetic Map	2	q41	UniSTS

RH143859

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	209,542,595 - 209,542,725 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	225,028,712 - 225,028,841	NCBI	Rnor6.0
Rnor_5.0	2	243,067,723 - 243,067,852	UniSTS	Rnor5.0
RGSC_v3.4	2	218,068,447 - 218,068,576	UniSTS	RGSC3.4
Celera	2	201,974,647 - 201,974,776	UniSTS
RH 3.4 Map	2	1517.6	UniSTS
Cytogenetic Map	2	q41	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	7	10	74	35	35	11	7
Low							1	1			6		1
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019359	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102991	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC062020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209647	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228936	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U06755	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000015579 ⟹ ENSRNOP00000015579

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	209,518,948 - 209,550,104 (+)	Ensembl
Rnor_6.0 Ensembl	2	225,005,019 - 225,036,188 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000104611 ⟹ ENSRNOP00000093982

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	209,541,826 - 209,550,104 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000114771 ⟹ ENSRNOP00000077681

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	209,518,948 - 209,549,860 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000119824 ⟹ ENSRNOP00000092181

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	209,518,948 - 209,549,860 (+)	Ensembl

RefSeq Acc Id:

NM_019359 ⟹ NP_062232

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	212,203,661 - 212,234,772 (+)	NCBI
mRatBN7.2	2	209,518,948 - 209,550,063 (+)	NCBI
Rnor_6.0	2	225,005,069 - 225,036,179 (+)	NCBI
Rnor_5.0	2	243,044,080 - 243,075,234 (+)	NCBI
RGSC_v3.4	2	218,044,803 - 218,075,914 (+)	RGD
Celera	2	201,950,953 - 201,982,114 (+)	RGD

Sequence:

show sequence

AGCAGAGCAGTCGGTCCCACTCCAGTGCGACCCGGAGCCTCTGCGGGACTCGAGTCCGAGCGAA
CCTCGAAGCATCATCCGCGTCCGTCTGCCGCGTTCCGGCTTCTGCGCCGCGCAGAGTAGCGAGC
TTGTGCATCACCCGCGCGGCCACAGCTGGGGGCTAAGAGCAGGGACACCGAGGGTGACTGACCC
CGACTCCGAGCGCAGCCCCTTCCTGTGGTCCGAACAGCCATGACCCACTTCAACAAGGGCCCTT
CCTACGGGCTCTCCGCCGAGGTCAAGAACAAGATCGCATCCAAGTATGACCAGCAGGCCGAGGA
GGATCTGCGCAACTGGATAGAAGAGGTGACAGGCATGGGCATTGGGACCAACTTCCAGCTGGGC
CTGAAGGACGGTATCATCCTCTGCGAACTCATAAACAAGCTACAGCCAGGCTCTGTGAAGAAAG
TCAACGAGTCCTCACTAAACTGGCCGCAGTTGGAGAACATCGGCAACTTTATTAAAGCCATCCA
GGCTTACGGTATGAAGCCCCATGACATATTTGAGGCAAACGACCTTTTTGAGAATGGCAACATG
ACCCAGGTTCAGACTACGCTGGTGGCTCTAGCAGGTCTGGCGAAAACAAAAGGATTCCATACAA
CCATTGACATCGGCGTTAAGTACGCAGAAAAACAGACACGACGCTTCGATGAAGGCAAGCTAAA
GGCTGGCCAAAGTGTAATCGGTTTACAGATGGGGACCAACAAATGTGCCAGCCAGGCGGGTATG
ACAGCCTATGGGACTCGGAGGCATCTTTATGATCCCAAAATGCAGACTGACAAACCCTTTGACC
AGACCACCATCAGTCTGCAGATGGGCACCAACAAAGGAGCCAGCCAGGCTGGCATGTCGGCACC
GGGTACCAGAAGAGACATCTATGACCAGAAGCTAACATTACAGCCGGTGGACAACTCGACCATT
TCTCTACAGATGGGCACCAACAAAGTTGCTTCCCAGAAAGGAATGAGCGTGTATGGGCTTGGGC
GGCAAGTGTATGACCCCAAGTACTGTGCCGCACCCACAGAACCTGTCATTCACAACGGAAGCCA
GGGCACGGGAACAAATGGGTCAGAAATCAGTGATAGCGATTACCAGGCAGAATACCCCGATGAG
TATCATGGCGAGTACCCAGATGAGTACCCTCGAGAGTACCAGTATGGTGACGACCAGGGCATCG
ATTACTAGAGTCACACACAGGAGTGCAGTATTTTAGTCCATTGTTTATCCAGTGAGACCCAAGC
TAGCCTTGAGTAATTCTTATCTCGTCTTCCTAAACACTATTACGCTTCCTGTACCTTTAAAGAA
TGCCTTACGTACATTCCTTTCTCCCTTTCCTGCCTCCTCCCTAAATTGCCTTCTAGTGCTGTAG
CGAGGGAAGCCTACAGCCTAACCAGTAACTCGCGTTGGAAGAAGTGAGAAGGAACGCTGTGCGA
GGGCAGCCAGCTCTTTCGCTGGAGATCTATAAAATTTTTTACACTTACACGTAAACTGGTATTT
TCAAACAATAGGAAACTATTTTTTTCTTTTTTACAGTTTAGTATGTATCTGGCTTGTACACGGT
AGACTAAGAAGTTGATTTGCTAAGTGTGGTCTTTGCCAAGTAATCTAACATGCAGCTTTAGAAC
CTGACACGTGGATGCTTCTGCACAGTGTTGTCTGCTAAGTTTTAAATAAAGTCGTGATCAGTGT
GATTCGTGATTACATGTGTACTCATTCTTTCCCGAAGCTGACAAGGTCTCTCCCGAGTGGCGCT
CTAAAGGCGCGTCTACAGAAATGGCCGCAGACATGTAGGTGTGGGTGGCGTGCCTGCAGACTTC
ATTTGTGCCAATGTATTACTGTAGAGTCGCTGTTCCCTTCAACTGTATTTATTGCTGCATTTCT
CAGCATAAACTT

hide sequence

RefSeq Acc Id:

XM_039102991 ⟹ XP_038958919

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	212,224,913 - 212,234,570 (+)	NCBI
mRatBN7.2	2	209,541,367 - 209,550,107 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_062232	(Get FASTA)	NCBI Sequence Viewer
	XP_038958919	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA18590	(Get FASTA)	NCBI Sequence Viewer
	AAH62020	(Get FASTA)	NCBI Sequence Viewer
	EDL82075	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015579.4
	ENSRNOP00000077681.1
	ENSRNOP00000092181
	ENSRNOP00000092181.1
	ENSRNOP00000093982.1
GenBank Protein	P37397	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062232 ⟸ NM_019359

- UniProtKB:

P37397 (UniProtKB/Swiss-Prot), A6HVE0 (UniProtKB/TrEMBL), A0A8I6AJV8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTHFNKGPSYGLSAEVKNKIASKYDQQAEEDLRNWIEEVTGMGIGTNFQLGLKDGIILCELINK
LQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGL
AKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPK
MQTDKPFDQTTISLQMGTNKGASQAGMSAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQK
GMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYPDEYPREY
QYGDDQGIDY

hide sequence

RefSeq Acc Id:

ENSRNOP00000015579 ⟸ ENSRNOT00000015579

RefSeq Acc Id:	XP_038958919 ⟸ XM_039102991
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AJV8 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000077681 ⟸ ENSRNOT00000114771

RefSeq Acc Id:

ENSRNOP00000093982 ⟸ ENSRNOT00000104611

RefSeq Acc Id:

ENSRNOP00000092181 ⟸ ENSRNOT00000119824

Protein Domains

Calponin-homology (CH)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P37397-F1-model_v2	AlphaFold	P37397	1-330	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691718

Promoter ID:

EPDNEW_R2243

Type:

initiation region

Name:

Cnn3_1

Description:

calponin 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	225,005,039 - 225,005,099	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71044	AgrOrtholog
BioCyc Gene	G2FUF-51413	BioCyc
Ensembl Genes	ENSRNOG00000011559	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015579.7	UniProtKB/TrEMBL
	ENSRNOT00000104611.1	UniProtKB/TrEMBL
	ENSRNOT00000114771.1	UniProtKB/TrEMBL
	ENSRNOT00000119824	ENTREZGENE
	ENSRNOT00000119824.1	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.418.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5623281	IMAGE-MGC_LOAD
InterPro	Calponin/LIMCH1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Calponin_repeat	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CH-domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CH_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM22_calponin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:54321	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72485	IMAGE-MGC_LOAD
NCBI Gene	54321	ENTREZGENE
PANTHER	CALPONIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CALPONIN	UniProtKB/TrEMBL
	CALPONIN-3	UniProtKB/TrEMBL
	MUSCLE-SPECIFIC PROTEIN 20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Calponin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PF00307	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cnn3	PhenoGen
PRINTS	CALPONIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM22CALPONIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	CALPONIN_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CALPONIN_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PS50021	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011559	RatGTEx
SMART	SM00033	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47576	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5YBZ5_RAT	UniProtKB/TrEMBL
	A0A8I6AJV8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q7M2_RAT	UniProtKB/TrEMBL
	A6HVE0	ENTREZGENE, UniProtKB/TrEMBL
	CNN3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-27	Cnn3	calponin 3	Cnn3	calponin 3, acidic	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-07-09	Cnn3	calponin 3, acidic			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_physical_interaction	binds F-actin and microtubule filaments	727577

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD