Symbol:
Dll3
Name:
delta like canonical Notch ligand 3
RGD ID:
70953
Description:
Enables Notch binding activity. Involved in negative regulation of Notch signaling pathway; negative regulation of astrocyte differentiation; and positive regulation of neurogenesis. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in dysostosis and spondylocostal dysostosis 1. Orthologous to human DLL3 (delta like canonical Notch ligand 3); PARTICIPATES IN altered Notch signaling pathway; altered Notch signaling pathway involving the main players; Notch signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,7-dihydropurine-6-thione; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
delta (Drosophila)-like 3; delta-like 3 (Drosophila); delta-like protein 3; delta3; drosophila Delta homolog 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 92,689,577 - 92,698,125 (-) NCBI GRCr8 mRatBN7.2 1 83,562,011 - 83,570,008 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 83,562,014 - 83,569,750 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 88,973,668 - 88,982,023 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 97,431,999 - 97,440,363 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 90,729,526 - 90,737,881 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 85,485,875 - 85,493,683 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 85,485,289 - 85,493,685 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 86,697,034 - 86,704,826 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 83,373,482 - 83,381,219 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 83,451,593 - 83,459,330 (-) NCBI Celera 1 77,961,035 - 77,968,719 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1.
Mutations in the human delta homologue, DLL3, cause axial skeletal defects in spondylocostal dysostosis.
Bulman MP, etal., Nat Genet. 2000 Apr;24(4):438-41.
2.
Axial skeletal defects caused by mutation in the spondylocostal dysplasia/pudgy gene Dll3 are associated with disruption of the segmentation clock within the presomitic mesoderm.
Dunwoodie SL, etal., Development. 2002 Apr;129(7):1795-806.
3.
Cell and molecular biology of Notch.
Fiuza UM and Arias AM, J Endocrinol. 2007 Sep;194(3):459-74.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Patterns of Jagged1, Jagged2, Delta-like 1 and Delta-like 3 expression during late embryonic and postnatal brain development suggest multiple functional roles in progenitors and differentiated cells.
Irvin DK, etal., J Neurosci Res 2004 Feb 1;75(3):330-43.
7.
The divergent DSL ligand Dll3 does not activate Notch signaling but cell autonomously attenuates signaling induced by other DSL ligands.
Ladi E, etal., J Cell Biol. 2005 Sep 12;170(6):983-92. Epub 2005 Sep 6.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
13.
GOA pipeline
RGD automated data pipeline
14.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Comprehensive gene review and curation
RGD comprehensive gene curation
17.
Information Derived from GenBank Report
RGD, Sept. 2003
18.
Diverse requirements for Notch signalling in mammals.
Sparrow DB, etal., Int J Dev Biol 2002;46(4):365-74.
Dll3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 92,689,577 - 92,698,125 (-) NCBI GRCr8 mRatBN7.2 1 83,562,011 - 83,570,008 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 83,562,014 - 83,569,750 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 88,973,668 - 88,982,023 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 97,431,999 - 97,440,363 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 90,729,526 - 90,737,881 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 85,485,875 - 85,493,683 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 85,485,289 - 85,493,685 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 86,697,034 - 86,704,826 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 83,373,482 - 83,381,219 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 83,451,593 - 83,459,330 (-) NCBI Celera 1 77,961,035 - 77,968,719 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
DLL3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 39,498,947 - 39,508,469 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 39,498,895 - 39,508,481 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 39,989,587 - 39,999,109 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 44,681,427 - 44,690,949 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 44,681,426 - 44,690,948 NCBI Celera 19 36,791,266 - 36,800,828 (+) NCBI Celera Cytogenetic Map 19 q13.2 NCBI HuRef 19 36,435,871 - 36,445,452 (+) NCBI HuRef CHM1_1 19 39,990,197 - 39,999,736 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 42,303,204 - 42,312,726 (+) NCBI T2T-CHM13v2.0
Dll3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 27,992,980 - 28,001,210 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 27,992,978 - 28,001,663 (-) Ensembl GRCm39 Ensembl GRCm38 7 28,293,555 - 28,301,785 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 28,293,553 - 28,302,238 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 29,078,574 - 29,086,804 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 28,002,336 - 28,010,544 (-) NCBI MGSCv36 mm8 Celera 7 22,855,195 - 22,863,426 (-) NCBI Celera Cytogenetic Map 7 A3 NCBI cM Map 7 16.67 NCBI
Dll3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955468 71,004 - 78,827 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955468 70,714 - 78,831 (-) NCBI ChiLan1.0 ChiLan1.0
DLL3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 45,794,577 - 45,804,191 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 47,665,162 - 47,674,775 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 36,597,420 - 36,607,021 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 45,144,641 - 45,154,854 (+) NCBI panpan1.1 PanPan1.1 panPan2
DLL3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 113,737,662 - 113,745,936 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 113,141,459 - 113,149,451 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 114,338,412 - 114,346,404 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 114,338,408 - 114,346,328 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 113,897,659 - 113,905,662 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 113,530,679 - 113,538,682 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 114,525,073 - 114,533,065 (-) NCBI UU_Cfam_GSD_1.0
Dll3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 13,893,682 - 13,904,131 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936661 2,322,531 - 2,329,953 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936661 2,322,531 - 2,330,150 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DLL3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 48,147,635 - 48,155,292 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 48,135,738 - 48,155,373 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 43,998,228 - 44,008,477 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DLL3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 34,102,433 - 34,114,558 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 34,103,854 - 34,114,103 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 12,125,291 - 12,136,981 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dll3
.
Predicted Target Of
Count of predictions: 215 Count of miRNA genes: 150 Interacting mature miRNAs: 165 Transcripts: ENSRNOT00000026182 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
RH140770
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 83,562,752 - 83,562,904 (-) MAPPER mRatBN7.2 Rnor_6.0 1 85,492,792 - 85,492,943 NCBI Rnor6.0 Rnor_5.0 1 86,703,935 - 86,704,086 UniSTS Rnor5.0 RGSC_v3.4 1 83,374,222 - 83,374,373 UniSTS RGSC3.4 Celera 1 77,961,775 - 77,961,926 UniSTS Cytogenetic Map 1 q21 UniSTS
RH141257
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 92,689,697 - 92,690,157 (+) Marker Load Pipeline mRatBN7.2 1 83,562,133 - 83,562,593 (-) MAPPER mRatBN7.2 Rnor_6.0 1 85,493,103 - 85,493,562 NCBI Rnor6.0 Rnor_5.0 1 86,704,246 - 86,704,705 UniSTS Rnor5.0 RGSC_v3.4 1 83,373,603 - 83,374,062 UniSTS RGSC3.4 Celera 1 77,961,156 - 77,961,615 UniSTS RH 3.4 Map 1 839.2 UniSTS Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
33
113
63
62
31
25
31
6
153
81
93
24
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026182 ⟹ ENSRNOP00000026182
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 83,562,014 - 83,569,750 (-) Ensembl Rnor_6.0 Ensembl 1 85,485,289 - 85,493,685 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076170
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 85,490,587 - 85,491,231 (+) Ensembl
RefSeq Acc Id:
NM_053666 ⟹ NP_446118
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 92,689,577 - 92,697,316 (-) NCBI mRatBN7.2 1 83,562,013 - 83,569,750 (-) NCBI Rnor_6.0 1 85,485,945 - 85,493,683 (+) NCBI Rnor_5.0 1 86,697,034 - 86,704,826 (+) NCBI RGSC_v3.4 1 83,373,482 - 83,381,219 (-) RGD Celera 1 77,961,035 - 77,968,719 (-) RGD
Sequence:
GGCACGAGCCCAAAAGCAATGGTCTCCCTGCAGGTGTCTTCACTTCCCCAGACGCTGATCCTGGCTTTTCTCCTTCCCCAGGCACTGCCAGCTGGTGTCTTCGAGCTACAAATTCATTCTTTCGGGCC
hide sequence
RefSeq Acc Id:
XM_006228611 ⟹ XP_006228673
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 92,689,577 - 92,698,125 (-) NCBI mRatBN7.2 1 83,562,011 - 83,570,008 (-) NCBI Rnor_6.0 1 85,485,875 - 85,493,683 (+) NCBI Rnor_5.0 1 86,697,034 - 86,704,826 (+) NCBI
Sequence:
GGGGCGTCCTCTCAGATATAAGGGTCCGGGATCCAGCAGCTGCGATTCCTGAGACTTTCCTCATCCTGTCCCCAAAAGCAATGGTCTCCCTGCAGGTGTCTTCACTTCCCCAGACGCTGATCCTGGCT
hide sequence
RefSeq Acc Id:
NP_446118 ⟸ NM_053666
- Peptide Label:
precursor
- UniProtKB:
O88671 (UniProtKB/Swiss-Prot), F1M9P5 (UniProtKB/TrEMBL)
- Sequence:
MVSLQVSSLPQTLILAFLLPQALPAGVFELQIHSFGPGPGPGTPRSPCNARGPCRLFFRVCLKPGVSQEAAESLCALGAALSTSGPVYTEQPGVPAAALSLPDGLVRVPFLDAWPGTFSLIIETWREQ
hide sequence
RefSeq Acc Id:
XP_006228673 ⟸ XM_006228611
- Peptide Label:
isoform X1
- UniProtKB:
O88671 (UniProtKB/Swiss-Prot), A6J9H5 (UniProtKB/TrEMBL)
- Sequence:
MVSLQVSSLPQTLILAFLLPQALPAGVFELQIHSFGPGPGPGTPRSPCNARGPCRLFFRVCLKPGVSQEAAESLCALGAALSTSGPVYTEQPGVPAAALSLPDGLVRVPFRDAWPGTFSLIIETWREQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000026182 ⟸ ENSRNOT00000026182
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-20
Dll3
delta like canonical Notch ligand 3
Dll3
delta-like 3 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-07-09
Dll3
delta-like 3 (Drosophila)
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
Note Type
Note
Reference
gene_expression
expressed in the proliferative EGL (external granule layer) of the brain during the first week of postnatal development, possibly suggesting communication between adjacent Dll3-expressing and Notch2-expressing cells
1304491
gene_expression
expressed in sparsely distributed cells within the ventricular germinal zones during the late embryonic stage and at relatively very low levels during the first week postnatal
1304491
