Symbol:
Trpv6
Name:
transient receptor potential cation channel, subfamily V, member 6
RGD ID:
69335
Description:
Enables calcium channel activity and identical protein binding activity. Involved in calcium ion import across plasma membrane and protein homotetramerization. Predicted to be located in apical plasma membrane. Predicted to be part of calcium channel complex. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in hyperparathyroidism. Orthologous to human TRPV6 (transient receptor potential cation channel subfamily V member 6); PARTICIPATES IN calcium transport pathway; calcium/calcium-mediated signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
calcium transport protein 1; CaT1; Ecac2; epithelial apical membrane calcium transporter/channel CaT1; epithelial calcium channel 2; osmosensitive transient receptor potential channel 3; Otrpc3; transient receptor potential cation channel subfamily V member 6; transient receptor potential cation channel, subfamily 5, member 6
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TRPV6 (transient receptor potential cation channel subfamily V member 6) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Trpv6 (transient receptor potential cation channel, subfamily V, member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Trpv6 (transient receptor potential cation channel subfamily V member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100990398 (transient receptor potential cation channel subfamily V member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TRPV6 (transient receptor potential cation channel subfamily V member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Trpv6 (transient receptor potential cation channel subfamily V member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TRPV5 (transient receptor potential cation channel subfamily V member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TRPV6 (transient receptor potential cation channel subfamily V member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Trpv6 (transient receptor potential cation channel subfamily V member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TRPV5 (transient receptor potential cation channel subfamily V member 5) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
TRPV6 (transient receptor potential cation channel subfamily V member 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Trpv6 (transient receptor potential cation channel, subfamily V, member 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
trpv6 (transient receptor potential cation channel, subfamily V, member 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ocr-1
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
nan
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
ocr-2
Alliance
DIOPT (InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
ocr-3
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
ocr-4
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
iav
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
YVC1
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
cat1
Alliance
DIOPT (OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 71,474,006 - 71,489,667 (-) NCBI GRCr8 mRatBN7.2 4 70,507,347 - 70,523,013 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 70,507,348 - 70,523,017 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 75,424,871 - 75,440,482 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 71,338,124 - 71,353,735 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 69,746,459 - 69,762,055 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 70,918,631 - 70,934,291 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 70,918,632 - 70,934,295 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 135,705,692 - 135,721,356 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 69,331,973 - 69,347,633 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 69,608,103 - 69,623,760 (-) NCBI Celera 4 65,472,398 - 65,488,058 (-) NCBI Celera Cytogenetic Map 4 q23 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Trpv6 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of TRPV6 mRNA CTD PMID:17557909 Trpv6 Rat 17alpha-ethynylestradiol multiple interactions ISO Trpv6 (Mus musculus) 6480464 [Ethinyl Estradiol co-treated with Streptozocin] results in increased expression of TRPV6 mRNA CTD PMID:29935216 Trpv6 Rat 17alpha-ethynylestradiol decreases expression ISO Trpv6 (Mus musculus) 6480464 Ethinyl Estradiol analog results in decreased expression of TRPV6 mRNA more ... CTD PMID:23142789 and PMID:27690074 Trpv6 Rat 17beta-estradiol multiple interactions EXP 6480464 [Progesterone co-treated with Estradiol] results in increased expression of TRPV6 mRNA CTD PMID:21228508 Trpv6 Rat 17beta-estradiol increases expression ISO Trpv6 (Mus musculus) 6480464 Estradiol results in increased expression of TRPV6 mRNA and Estradiol results in increased expression of TRPV6 protein CTD PMID:30061528 Trpv6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TRPV6 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TRPV6 mRNA CTD PMID:26159488 Trpv6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TRPV6 mRNA CTD PMID:33387578 Trpv6 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO TRPV6 (Homo sapiens) 6480464 Endosulfan inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of TRPV6 mRNA] CTD PMID:26159488 Trpv6 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO TRPV6 (Homo sapiens) 6480464 [3 more ... CTD PMID:31820026 Trpv6 Rat 3,7-dihydropurine-6-thione increases expression EXP 6480464 Mercaptopurine results in increased expression of TRPV6 mRNA CTD PMID:23358152 Trpv6 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of TRPV6 mRNA CTD PMID:36041667 Trpv6 Rat 4-hydroxyphenyl retinamide increases expression ISO Trpv6 (Mus musculus) 6480464 Fenretinide results in increased expression of TRPV6 mRNA CTD PMID:28973697 Trpv6 Rat 4-tert-Octylphenol affects expression ISO Trpv6 (Mus musculus) 6480464 4-tert-octylphenol affects the expression of TRPV6 mRNA and 4-tert-octylphenol affects the expression of TRPV6 protein CTD PMID:30061528 Trpv6 Rat 4-tert-Octylphenol multiple interactions ISO Trpv6 (Mus musculus) 6480464 Fulvestrant promotes the reaction [4-tert-octylphenol results in increased expression of TRPV6 mRNA] CTD PMID:30061528 Trpv6 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TRPV6 mRNA CTD PMID:30047161 Trpv6 Rat actinomycin D multiple interactions ISO TRPV6 (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [1 and 25-dihydroxyvitamin D results in increased expression of TRPV6 mRNA] CTD PMID:16362534 Trpv6 Rat aflatoxin B1 increases expression ISO TRPV6 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of TRPV6 mRNA CTD PMID:22100608 Trpv6 Rat aflatoxin B1 decreases methylation ISO TRPV6 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TRPV6 exon CTD PMID:30157460 Trpv6 Rat alfacalcidol increases expression ISO Trpv6 (Mus musculus) 6480464 alfacalcidol results in increased expression of TRPV6 mRNA CTD PMID:18180267 Trpv6 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of TRPV6 mRNA CTD PMID:38685447 Trpv6 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of TRPV6 mRNA CTD PMID:30047161 Trpv6 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TRPV6 mRNA CTD PMID:16483693 Trpv6 Rat Aroclor 1254 decreases expression ISO Trpv6 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of TRPV6 protein CTD PMID:22406624 Trpv6 Rat arsenite(3-) increases methylation ISO TRPV6 (Homo sapiens) 6480464 arsenite results in increased methylation of TRPV6 promoter CTD PMID:23974009 Trpv6 Rat Azoxymethane multiple interactions ISO Trpv6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of TRPV6 mRNA CTD PMID:29950665 Trpv6 Rat barium(0) increases uptake ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased uptake of Barium CTD PMID:19996302 and PMID:21146870 Trpv6 Rat benzo[a]pyrene increases expression ISO Trpv6 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TRPV6 mRNA CTD PMID:23735875 Trpv6 Rat benzo[a]pyrene increases methylation ISO TRPV6 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TRPV6 3' UTR CTD PMID:27901495 Trpv6 Rat benzo[a]pyrene decreases methylation ISO TRPV6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of TRPV6 exon CTD PMID:27901495 Trpv6 Rat benzo[a]pyrene affects methylation ISO TRPV6 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TRPV6 promoter CTD PMID:27901495 Trpv6 Rat beta-lapachone decreases expression ISO TRPV6 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of TRPV6 mRNA CTD PMID:38218311 Trpv6 Rat bisphenol A decreases expression ISO Trpv6 (Mus musculus) 6480464 bisphenol A results in decreased expression of TRPV6 mRNA and bisphenol A results in decreased expression of TRPV6 protein CTD PMID:23142789 more ... Trpv6 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of TRPV6 mRNA CTD PMID:36041667 Trpv6 Rat bisphenol A multiple interactions ISO TRPV6 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TRPV6 gene CTD PMID:31601247 Trpv6 Rat bisphenol A decreases methylation ISO TRPV6 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of TRPV6 gene CTD PMID:31601247 Trpv6 Rat bisphenol A increases expression ISO Trpv6 (Mus musculus) 6480464 bisphenol A results in increased expression of TRPV6 protein CTD PMID:30061528 Trpv6 Rat bisphenol A multiple interactions ISO Trpv6 (Mus musculus) 6480464 [bisphenol A co-treated with Streptozocin] results in increased expression of TRPV6 mRNA and [Fulvestrant co-treated with bisphenol A] results in increased expression of TRPV6 mRNA CTD PMID:29935216 and PMID:30061528 Trpv6 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TRPV6 mRNA CTD PMID:25181051 Trpv6 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of TRPV6 mRNA CTD PMID:36041667 Trpv6 Rat cadmium atom multiple interactions ISO TRPV6 (Homo sapiens) 6480464 2-aminoethoxydiphenyl borate inhibits the reaction [TRPV6 protein results in increased import of Cadmium] and Cadmium inhibits the reaction [TRPV6 protein results in increased uptake of Calcium] CTD PMID:21146870 and PMID:23968883 Trpv6 Rat cadmium atom multiple interactions ISO Trpv6 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TRPV6 mRNA CTD PMID:37325564 Trpv6 Rat cadmium atom increases import ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased import of Cadmium CTD PMID:23968883 Trpv6 Rat cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of TRPV6 mRNA CTD PMID:32879253 Trpv6 Rat cadmium atom increases uptake ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased uptake of Cadmium CTD PMID:21146870 Trpv6 Rat cadmium dichloride multiple interactions ISO Trpv6 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TRPV6 mRNA CTD PMID:37325564 Trpv6 Rat calciol multiple interactions ISO TRPV6 (Homo sapiens) 6480464 [3 more ... CTD PMID:31820026 Trpv6 Rat calcitriol multiple interactions ISO TRPV6 (Homo sapiens) 6480464 [Calcitriol binds to and results in increased activity of VDR protein] which results in increased expression of TRPV6 mRNA more ... CTD PMID:15489543 more ... Trpv6 Rat calcitriol increases expression ISO TRPV6 (Homo sapiens) 6480464 Calcitriol results in increased expression of TRPV6 mRNA and Calcitriol results in increased expression of TRPV6 protein CTD PMID:16491319 more ... Trpv6 Rat calcium atom increases uptake ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased uptake of Calcium CTD PMID:19996302 and PMID:21146870 Trpv6 Rat calcium atom multiple interactions ISO Trpv6 (Mus musculus) 6480464 [[USP2 gene mutant form results in increased expression of NHERF4 protein] which results in increased activity of TRPV6 protein] which results in increased uptake of Calcium CTD PMID:26756164 Trpv6 Rat calcium atom increases expression ISO Trpv6 (Mus musculus) 6480464 Calcium deficiency results in increased expression of TRPV6 mRNA CTD PMID:18648087 Trpv6 Rat calcium atom increases transport ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased transport of Calcium CTD PMID:12584203 Trpv6 Rat calcium atom multiple interactions ISO TRPV6 (Homo sapiens) 6480464 4-O-methyl-12-O-tetradecanoylphorbol 13-acetate inhibits the reaction [Tamoxifen inhibits the reaction [TRPV6 protein results in increased uptake of Calcium]] more ... CTD PMID:17292493 more ... Trpv6 Rat calcium(0) increases uptake ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased uptake of Calcium CTD PMID:19996302 and PMID:21146870 Trpv6 Rat calcium(0) multiple interactions ISO Trpv6 (Mus musculus) 6480464 [[USP2 gene mutant form results in increased expression of NHERF4 protein] which results in increased activity of TRPV6 protein] which results in increased uptake of Calcium CTD PMID:26756164 Trpv6 Rat calcium(0) increases expression ISO Trpv6 (Mus musculus) 6480464 Calcium deficiency results in increased expression of TRPV6 mRNA CTD PMID:18648087 Trpv6 Rat calcium(0) increases transport ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased transport of Calcium CTD PMID:12584203 Trpv6 Rat calcium(0) multiple interactions ISO TRPV6 (Homo sapiens) 6480464 4-O-methyl-12-O-tetradecanoylphorbol 13-acetate inhibits the reaction [Tamoxifen inhibits the reaction [TRPV6 protein results in increased uptake of Calcium]] more ... CTD PMID:17292493 more ... Trpv6 Rat Calphostin C multiple interactions ISO TRPV6 (Homo sapiens) 6480464 calphostin C inhibits the reaction [TRPV6 protein results in increased uptake of Calcium] CTD PMID:19996302 Trpv6 Rat capsaicin multiple interactions ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein promotes the reaction [Capsaicin results in increased abundance of Calcium] and TRPV6 protein promotes the reaction [Capsaicin results in increased expression of BAX protein] CTD PMID:17292493 Trpv6 Rat capsaicin increases response to substance ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased susceptibility to Capsaicin CTD PMID:17292493 Trpv6 Rat carbon nanotube increases expression ISO Trpv6 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Trpv6 Rat CGP 52608 multiple interactions ISO TRPV6 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TRPV6 gene] CTD PMID:28238834 Trpv6 Rat chlordecone decreases expression ISO Trpv6 (Mus musculus) 6480464 Chlordecone results in decreased expression of TRPV6 mRNA CTD PMID:33711761 Trpv6 Rat chlorpyrifos decreases expression ISO Trpv6 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of TRPV6 mRNA CTD PMID:37019170 Trpv6 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of TRPV6 mRNA CTD PMID:26033743 Trpv6 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of TRPV6 mRNA CTD PMID:26033743 Trpv6 Rat curcumin multiple interactions ISO TRPV6 (Homo sapiens) 6480464 [Curcumin binds to and results in increased activity of VDR protein] which results in increased expression of TRPV6 mRNA CTD PMID:20153625 Trpv6 Rat dextran sulfate multiple interactions ISO Trpv6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of TRPV6 mRNA CTD PMID:29950665 Trpv6 Rat dimethylarsinic acid multiple interactions ISO Trpv6 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of TRPV6 mRNA CTD PMID:34876320 Trpv6 Rat endosulfan multiple interactions ISO TRPV6 (Homo sapiens) 6480464 Endosulfan inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of TRPV6 mRNA] CTD PMID:26159488 Trpv6 Rat ethylparaben increases expression ISO TRPV6 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of TRPV6 mRNA CTD PMID:37690743 Trpv6 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of TRPV6 mRNA CTD PMID:18035473 Trpv6 Rat formononetin multiple interactions ISO Trpv6 (Mus musculus) 6480464 formononetin inhibits the reaction [Streptozocin results in decreased expression of TRPV6 mRNA] CTD PMID:35315182 Trpv6 Rat fulvestrant multiple interactions ISO Trpv6 (Mus musculus) 6480464 [Fulvestrant co-treated with bisphenol A] results in increased expression of TRPV6 mRNA and Fulvestrant promotes the reaction [4-tert-octylphenol results in increased expression of TRPV6 mRNA] CTD PMID:30061528 Trpv6 Rat fulvestrant multiple interactions ISO TRPV6 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TRPV6 gene CTD PMID:31601247 Trpv6 Rat fulvestrant increases expression ISO Trpv6 (Mus musculus) 6480464 Fulvestrant results in increased expression of TRPV6 protein CTD PMID:30061528 Trpv6 Rat furosemide increases expression ISO Trpv6 (Mus musculus) 6480464 Furosemide results in increased expression of TRPV6 mRNA CTD PMID:17652376 Trpv6 Rat gadolinium atom increases uptake ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased uptake of Gadolinium CTD PMID:21146870 Trpv6 Rat gadolinium atom multiple interactions ISO TRPV6 (Homo sapiens) 6480464 Gadolinium inhibits the reaction [TRPV6 protein results in increased uptake of Calcium] CTD PMID:21146870 Trpv6 Rat gentamycin increases expression ISO Trpv6 (Mus musculus) 6480464 Gentamicins results in increased expression of TRPV6 mRNA CTD PMID:17652376 Trpv6 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of TRPV6 mRNA CTD PMID:33387578 Trpv6 Rat lanthanum atom increases uptake ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased uptake of Lanthanum CTD PMID:21146870 Trpv6 Rat lanthanum atom multiple interactions ISO TRPV6 (Homo sapiens) 6480464 Lanthanum inhibits the reaction [TRPV6 protein results in increased uptake of Calcium] CTD PMID:21146870 Trpv6 Rat lithocholic acid multiple interactions ISO TRPV6 (Homo sapiens) 6480464 [Lithocholic Acid analog binds to and results in increased activity of VDR protein] which results in increased expression of TRPV6 mRNA and [Lithocholic Acid binds to and results in increased activity of VDR protein] which results in increased expression of TRPV6 mRNA CTD PMID:15489543 and PMID:18180267 Trpv6 Rat lithocholic acid increases expression EXP 6480464 Lithocholic Acid results in increased expression of TRPV6 mRNA CTD PMID:17535892 Trpv6 Rat manganese atom increases uptake ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased uptake of Manganese CTD PMID:21146870 Trpv6 Rat manganese(0) increases uptake ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased uptake of Manganese CTD PMID:21146870 Trpv6 Rat mercaptopurine increases expression EXP 6480464 Mercaptopurine results in increased expression of TRPV6 mRNA CTD PMID:23358152 Trpv6 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of TRPV6 mRNA CTD PMID:30047161 Trpv6 Rat methotrexate increases expression ISO TRPV6 (Homo sapiens) 6480464 Methotrexate results in increased expression of TRPV6 mRNA CTD PMID:21678067 Trpv6 Rat methylarsonic acid multiple interactions ISO Trpv6 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of TRPV6 mRNA CTD PMID:34876320 Trpv6 Rat p-tert-Amylphenol multiple interactions ISO Trpv6 (Mus musculus) 6480464 Fulvestrant promotes the reaction [4-tert-octylphenol results in increased expression of TRPV6 mRNA] CTD PMID:30061528 Trpv6 Rat p-tert-Amylphenol affects expression ISO Trpv6 (Mus musculus) 6480464 4-tert-octylphenol affects the expression of TRPV6 mRNA and 4-tert-octylphenol affects the expression of TRPV6 protein CTD PMID:30061528 Trpv6 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TRPV6 mRNA CTD PMID:33387578 Trpv6 Rat perfluorohexanesulfonic acid decreases expression ISO TRPV6 (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in decreased expression of TRPV6 mRNA CTD PMID:25812627 Trpv6 Rat perfluorononanoic acid decreases expression ISO TRPV6 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of TRPV6 mRNA CTD PMID:25812627 Trpv6 Rat perfluorooctane-1-sulfonic acid decreases expression ISO TRPV6 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of TRPV6 mRNA CTD PMID:25812627 Trpv6 Rat perfluorooctanoic acid multiple interactions ISO TRPV6 (Homo sapiens) 6480464 perfluorooctanoic acid inhibits the reaction [Calcitriol results in increased expression of TRPV6 mRNA] CTD PMID:33033332 Trpv6 Rat perfluorooctanoic acid decreases expression ISO TRPV6 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of TRPV6 mRNA CTD PMID:25812627 Trpv6 Rat potassium dichromate decreases expression ISO Trpv6 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of TRPV6 mRNA CTD PMID:23608068 Trpv6 Rat progesterone multiple interactions EXP 6480464 [Progesterone co-treated with Estradiol] results in increased expression of TRPV6 mRNA CTD PMID:21228508 Trpv6 Rat purine-6-thiol increases expression EXP 6480464 Mercaptopurine results in increased expression of TRPV6 mRNA CTD PMID:23358152 Trpv6 Rat quercetin multiple interactions ISO TRPV6 (Homo sapiens) 6480464 VDR promotes the reaction [Quercetin results in increased expression of TRPV6 mRNA] CTD PMID:26366751 Trpv6 Rat quercetin increases expression ISO TRPV6 (Homo sapiens) 6480464 Quercetin results in increased expression of TRPV6 mRNA CTD PMID:26366751 Trpv6 Rat resveratrol multiple interactions ISO TRPV6 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of TRPV6 mRNA CTD PMID:23557933 Trpv6 Rat sodium arsenate multiple interactions ISO Trpv6 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of TRPV6 mRNA CTD PMID:34876320 Trpv6 Rat sodium arsenite decreases expression ISO TRPV6 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TRPV6 mRNA CTD PMID:34032870 Trpv6 Rat sodium arsenite increases expression ISO Trpv6 (Mus musculus) 6480464 sodium arsenite results in increased expression of TRPV6 mRNA CTD PMID:37682722 Trpv6 Rat sodium arsenite multiple interactions ISO Trpv6 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of TRPV6 mRNA CTD PMID:34876320 Trpv6 Rat sodium dichromate increases expression ISO Trpv6 (Mus musculus) 6480464 sodium bichromate results in increased expression of TRPV6 mRNA CTD PMID:22155349 Trpv6 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of TRPV6 mRNA CTD PMID:22561333 Trpv6 Rat streptozocin decreases expression ISO Trpv6 (Mus musculus) 6480464 Streptozocin results in decreased expression of TRPV6 mRNA CTD PMID:29935216 and PMID:35315182 Trpv6 Rat streptozocin multiple interactions ISO Trpv6 (Mus musculus) 6480464 [bisphenol A co-treated with Streptozocin] results in increased expression of TRPV6 mRNA more ... CTD PMID:29935216 and PMID:35315182 Trpv6 Rat strontium atom increases uptake ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased uptake of Strontium CTD PMID:21146870 Trpv6 Rat tamoxifen multiple interactions ISO TRPV6 (Homo sapiens) 6480464 4-O-methyl-12-O-tetradecanoylphorbol 13-acetate inhibits the reaction [Tamoxifen inhibits the reaction [TRPV6 protein results in increased uptake of Calcium]] and Tamoxifen inhibits the reaction [TRPV6 protein results in increased uptake of Calcium] CTD PMID:19996302 Trpv6 Rat tebuconazole decreases expression ISO TRPV6 (Homo sapiens) 6480464 tebuconazole results in decreased expression of TRPV6 mRNA CTD PMID:30458266 Trpv6 Rat testosterone multiple interactions ISO TRPV6 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of TRPV6 mRNA and Testosterone affects the reaction [Calcitriol results in increased expression of TRPV6 mRNA] CTD PMID:21592394 Trpv6 Rat testosterone multiple interactions ISO Trpv6 (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Trpv6 Rat testosterone decreases expression ISO Trpv6 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of TRPV6 mRNA CTD PMID:33848595 Trpv6 Rat testosterone decreases expression ISO TRPV6 (Homo sapiens) 6480464 Testosterone results in decreased expression of TRPV6 mRNA CTD PMID:21592394 Trpv6 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TRPV6 mRNA CTD PMID:34492290 Trpv6 Rat titanium dioxide increases expression ISO Trpv6 (Mus musculus) 6480464 titanium dioxide results in increased expression of TRPV6 mRNA CTD PMID:23557971 and PMID:27760801 Trpv6 Rat titanium dioxide multiple interactions ISO Trpv6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of TRPV6 mRNA CTD PMID:29950665 Trpv6 Rat triclosan increases expression ISO TRPV6 (Homo sapiens) 6480464 Triclosan results in increased expression of TRPV6 mRNA CTD PMID:30510588 Trpv6 Rat valproic acid increases methylation ISO TRPV6 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of TRPV6 gene CTD PMID:29154799 Trpv6 Rat zinc atom increases uptake ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased uptake of Zinc CTD PMID:21146870 Trpv6 Rat zinc(0) increases uptake ISO TRPV6 (Homo sapiens) 6480464 TRPV6 protein results in increased uptake of Zinc CTD PMID:21146870
17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,7-dihydropurine-6-thione (EXP) 4,4'-sulfonyldiphenol (EXP) 4-hydroxyphenyl retinamide (ISO) 4-tert-Octylphenol (ISO) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) alfacalcidol (ISO) amitrole (EXP) ammonium chloride (EXP) Aroclor 1254 (ISO) arsenite(3-) (ISO) Azoxymethane (ISO) barium(0) (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium atom (EXP,ISO) cadmium dichloride (ISO) calciol (ISO) calcitriol (ISO) calcium atom (ISO) calcium(0) (ISO) Calphostin C (ISO) capsaicin (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) chlorpyrifos (ISO) copper atom (EXP) copper(0) (EXP) curcumin (ISO) dextran sulfate (ISO) dimethylarsinic acid (ISO) endosulfan (ISO) ethylparaben (ISO) flavonoids (EXP) formononetin (ISO) fulvestrant (ISO) furosemide (ISO) gadolinium atom (ISO) gentamycin (EXP,ISO) lanthanum atom (ISO) lithocholic acid (EXP,ISO) manganese atom (ISO) manganese(0) (ISO) mercaptopurine (EXP) methimazole (EXP) methotrexate (ISO) methylarsonic acid (ISO) p-tert-Amylphenol (ISO) paracetamol (EXP) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) potassium dichromate (ISO) progesterone (EXP) purine-6-thiol (EXP) quercetin (ISO) resveratrol (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dichromate (EXP,ISO) streptozocin (ISO) strontium atom (ISO) tamoxifen (ISO) tebuconazole (ISO) testosterone (ISO) thioacetamide (EXP) titanium dioxide (ISO) triclosan (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
calcium ion homeostasis (IEA,ISO,ISS) calcium ion import (IDA) calcium ion import across plasma membrane (IBA,IEA,IMP,ISO,ISS) calcium ion transmembrane transport (IDA,IEA,ISO) calcium ion transport (IEA,ISO) monoatomic ion transmembrane transport (IEA) monoatomic ion transport (IEA) parathyroid hormone secretion (IEA,ISO) protein homotetramerization (IPI) response to calcium ion (IEA,ISO,ISS) transmembrane transport (IEA)
1.
The recombinant human TRPV6 channel functions as Ca2+ sensor in human embryonic kidney and rat basophilic leukemia cells.
Bodding M, etal., J Biol Chem 2002 Sep 27;277(39):36656-64.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
Molecular cloning and characterization of a channel-like transporter mediating intestinal calcium absorption.
Peng JB, etal., J Biol Chem 1999 Aug 6;274(32):22739-46.
7.
A rat kidney-specific calcium transporter in the distal nephron.
Peng JB, etal., J Biol Chem 2000 Sep 8;275(36):28186-94.
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Crystal structure of the epithelial calcium channel TRPV6.
Saotome K, etal., Nature. 2016 Jun 13;534(7608):506-11. doi: 10.1038/nature17975.
12.
Store depletion-activated CaT1 currents in rat basophilic leukemia mast cells are inhibited by 2-aminoethoxydiphenyl borate. Evidence for a regulatory component that controls activation of both CaT1 and CRAC (Ca(2+) release-activated Ca(2+) channel) channels.
Schindl R, etal., J Biol Chem 2002 Jul 26;277(30):26950-8.
13.
Disrupted placental vitamin D metabolism and calcium signaling in gestational diabetes and pre-eclampsia patients.
Varshney S, etal., Endocrine. 2023 Apr;80(1):191-200. doi: 10.1007/s12020-022-03272-9. Epub 2022 Dec 8.
14.
International Union of Basic and Clinical Pharmacology. LXXVI. Current progress in the mammalian TRP ion channel family.
Wu LJ, etal., Pharmacol Rev. 2010 Sep;62(3):381-404. doi: 10.1124/pr.110.002725.
Trpv6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 71,474,006 - 71,489,667 (-) NCBI GRCr8 mRatBN7.2 4 70,507,347 - 70,523,013 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 70,507,348 - 70,523,017 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 75,424,871 - 75,440,482 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 71,338,124 - 71,353,735 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 69,746,459 - 69,762,055 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 70,918,631 - 70,934,291 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 70,918,632 - 70,934,295 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 135,705,692 - 135,721,356 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 69,331,973 - 69,347,633 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 69,608,103 - 69,623,760 (-) NCBI Celera 4 65,472,398 - 65,488,058 (-) NCBI Celera Cytogenetic Map 4 q23 NCBI
TRPV6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 142,871,208 - 142,885,745 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 142,871,208 - 142,885,745 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 142,568,961 - 142,583,490 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 142,279,082 - 142,293,599 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 142,085,796 - 142,100,314 NCBI Celera 7 137,406,262 - 137,420,596 (-) NCBI Celera Cytogenetic Map 7 q34 NCBI HuRef 7 136,907,167 - 136,921,549 (-) NCBI HuRef CHM1_1 7 142,505,175 - 142,519,717 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 144,227,023 - 144,241,552 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 141,970,820 - 141,985,355 (-) NCBI
Trpv6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 41,597,553 - 41,613,339 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 41,597,558 - 41,613,339 (-) Ensembl GRCm39 Ensembl GRCm38 6 41,620,619 - 41,636,405 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 41,620,624 - 41,636,405 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 41,570,618 - 41,586,404 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 41,550,232 - 41,565,942 (-) NCBI MGSCv36 mm8 Celera 6 41,573,210 - 41,588,993 (-) NCBI Celera Cytogenetic Map 6 B2.1 NCBI cM Map 6 19.79 NCBI
Trpv6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955494 818,643 - 836,126 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955494 820,801 - 835,931 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100990398 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 179,719,619 - 179,734,609 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 31,729,875 - 31,744,866 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 134,862,223 - 134,877,051 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 147,353,684 - 147,368,475 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 147,353,684 - 147,368,475 (-) Ensembl panpan1.1 panPan2
TRPV6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 6,691,521 - 6,706,205 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 6,691,254 - 6,706,207 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 16 6,602,597 - 6,617,275 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 6,602,330 - 6,617,284 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 6,555,020 - 6,570,553 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 6,407,357 - 6,422,030 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 6,466,102 - 6,480,792 (+) NCBI UU_Cfam_GSD_1.0
Trpv6
TRPV5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 7,332,222 - 7,348,381 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 7,332,253 - 7,348,383 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 7,626,724 - 7,652,621 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TRPV6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 111,750,821 - 111,766,274 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 111,750,945 - 111,765,450 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666072 8,474,129 - 8,489,168 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Trpv6
.
Predicted Target Of
Count of predictions: 85 Count of miRNA genes: 61 Interacting mature miRNAs: 79 Transcripts: ENSRNOT00000020616 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1549843 Bw53 Body weight QTL 53 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 103194791 Rat 61445 Strs3 Sensitivity to stroke QTL 3 3 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 4 40433388 85433388 Rat 6893678 Bw108 Body weight QTL 108 2.6 0.006 body mass (VT:0001259) body weight (CMO:0000012) 4 43457976 88457976 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1358363 Sradr3 Stress Responsive Adrenal Weight QTL 3 6.19 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 4 57486946 102486946 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 61336 Bp21 Blood pressure QTL 21 4.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114705 78881294 Rat 1549839 Bw52 Body weight QTL 52 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 115089733 Rat 6909128 Pancm4 Pancreatic morphology QTL 4 11.35 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 4 26907285 75585128 Rat 61475 Aia2 Adjuvant induced arthritis QTL 2 5.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 39505275 73892441 Rat 8694439 Bw168 Body weight QTL 168 9.57 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 40433414 85433414 Rat 8655906 Rf60 Renal function QTL 60 3.8 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 4 29494195 81006281 Rat 2317577 Eae24 Experimental allergic encephalomyelitis QTL 24 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 4 66993185 72752834 Rat 6909122 Insul22 Insulin level QTL 22 4.63 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 4 26907285 75585128 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 2300179 Bmd50 Bone mineral density QTL 50 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 4 60928534 105928534 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 70192 BpQTLcluster5 Blood pressure QTL cluster 5 4.183 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 4 62933508 114921294 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1578657 Bss12 Bone structure and strength QTL 12 8.9 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 4 60220938 105220938 Rat 1578658 Bss13 Bone structure and strength QTL 13 8 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 4 60220938 105220938 Rat 4889969 Bss96 Bone structure and strength QTL 96 4.9 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 4 56647776 78882945 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 4889972 Bss97 Bone structure and strength QTL 97 5.6 tibia size trait (VT:0100001) tibia total bone volume (CMO:0001724) 4 56647776 78882945 Rat 6478684 Anxrr30 Anxiety related response QTL 30 0.00087 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 5685012 Bmd87 Bone mineral density QTL 87 5.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 4 56647776 78882945 Rat 5685009 Bmd86 Bone mineral density QTL 86 3.7 tibia mineral mass (VT:1000283) bone mineral density (CMO:0001226) 4 56647776 78882945 Rat 1331807 Rf31 Renal function QTL 31 2.988 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 4 39524264 74726312 Rat 8552782 Vie1 Viral induced encephalitis QTL 1 26.4 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 634311 Sach7 Saccharin preference QTL 7 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 57114432 81266970 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 6478772 Anxrr49 Anxiety related response QTL 49 0.15488 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 2312569 Pur19 Proteinuria QTL 19 3.4 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 4 65882107 96130297 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 8552801 Bw143 Body weight QTL 143 7.3 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 4 34430484 82490359 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 8552807 Vie4 Viral induced encephalitis QTL 4 7.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 62933508 82490359 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 631651 Bp124 Blood pressure QTL 124 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 62879517 107879517 Rat 8552809 Vie5 Viral induced encephalitis QTL 5 25.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1558651 Swd3 Spike wave discharge measurement QTL 3 4.62 0.000024 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 4 58432133 92991462 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 631546 Bp86 Blood pressure QTL 86 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114432 91360801 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 6478743 Anxrr40 Anxiety related response QTL 40 0.83076 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 7394826 Bw126 Body weight QTL 126 0.002 body mass (VT:0001259) body weight gain (CMO:0000420) 4 62933269 87483707 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat 631671 Iddm11 Insulin dependent diabetes mellitus QTL 11 3.6 0.0012 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 58635877 78886137 Rat
RH129621
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 70,507,017 - 70,507,219 (+) MAPPER mRatBN7.2 Rnor_6.0 4 70,918,302 - 70,918,503 NCBI Rnor6.0 Rnor_5.0 4 135,705,367 - 135,705,568 UniSTS Rnor5.0 RGSC_v3.4 4 69,331,644 - 69,331,845 UniSTS RGSC3.4 Celera 4 65,472,069 - 65,472,270 UniSTS RH 3.4 Map 4 419.81 UniSTS Cytogenetic Map 4 q22 UniSTS
AI412357
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 70,509,277 - 70,509,441 (+) MAPPER mRatBN7.2 Rnor_6.0 4 70,920,562 - 70,920,725 NCBI Rnor6.0 Rnor_5.0 4 135,707,627 - 135,707,790 UniSTS Rnor5.0 RGSC_v3.4 4 69,333,904 - 69,334,067 UniSTS RGSC3.4 Celera 4 65,474,329 - 65,474,492 UniSTS RH 3.4 Map 4 419.61 UniSTS Cytogenetic Map 4 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
12
63
52
51
21
25
21
6
137
54
43
45
57
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020616 ⟹ ENSRNOP00000020616
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 70,507,348 - 70,523,017 (-) Ensembl Rnor_6.0 Ensembl 4 70,918,632 - 70,934,295 (-) Ensembl
RefSeq Acc Id:
NM_053686 ⟹ NP_446138
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 71,474,006 - 71,489,667 (-) NCBI mRatBN7.2 4 70,507,347 - 70,523,013 (-) NCBI Rnor_6.0 4 70,918,631 - 70,934,291 (-) NCBI Rnor_5.0 4 135,705,692 - 135,721,356 (-) NCBI RGSC_v3.4 4 69,331,973 - 69,347,633 (-) RGD Celera 4 65,472,398 - 65,488,058 (-) RGD
Sequence:
CCACGCGTCCGCACAGCTCCTGCTCACTCCCAACAGGAGCTCCGATATACAAGCCCAGCAGATTTCCAGCTCTGCCAAGTGGAACAAAGCAGGAGCCCTCTTCGGACTCCTAAGAGCAGCCACGGGAA
hide sequence
RefSeq Acc Id:
NP_446138 ⟸ NM_053686
- UniProtKB:
Q9R186 (UniProtKB/Swiss-Prot)
- Sequence:
MGWSLPKEKGLILCLWNKFCRWFHRRESWAQSRDEQNLLQQKRIWESPLLLAAKENNVQALIKLLKFEGCEVHQKGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000020616 ⟸ ENSRNOT00000020616
RGD ID: 13693003 Promoter ID: EPDNEW_R3526 Type: multiple initiation site Name: Trpv6_1 Description: transient receptor potential cation channel, subfamily V, member6 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 70,934,223 - 70,934,283 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2003-04-09
Trpv6
transient receptor potential cation channel, subfamily V, member 6
Symbol and Name updated
629477 APPROVED
2003-03-19
Trpv6
transient receptor potential cation channel, subfamily V, member 6
Ecac2
epithelial apical membrane calcium transporter/channel CaT1
Data merged from RGD:620637
628472 PROVISIONAL
2002-08-07
Ecac2
epithelial apical membrane calcium transporter/channel CaT1
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Trpv6
transient receptor potential cation channel, subfamily 5, member 6
Name updated
70584 APPROVED
2002-02-27
Ecac2
epithelial calcium channel 2
Symbol and Name updated to reflect Human and Mouse nomenclature
70292 APPROVED
Note Type
Note
Reference
gene_regulation
activated following Ca2+ store depletion
634426
