Symbol:
Hadh
Name:
hydroxyacyl-CoA dehydrogenase
RGD ID:
69321
Description:
Enables 3-hydroxyacyl-CoA dehydrogenase activity. Involved in several processes, including fatty acid beta-oxidation; negative regulation of insulin secretion; and response to insulin. Predicted to be located in cytoplasm and nucleoplasm. Predicted to be active in mitochondrion. Biomarker of myocardial infarction and obesity. Human ortholog(s) of this gene implicated in familial hyperinsulinemic hypoglycemia 4. Orthologous to human HADH (hydroxyacyl-CoA dehydrogenase); PARTICIPATES IN fatty acid beta degradation pathway; 2-aminoadipic 2-oxoadipic aciduria pathway; 3-hydroxyacyl-CoA dehydrogenase deficiency pathway; INTERACTS WITH (+)-schisandrin B; (R)-adrenaline; 1-naphthyl isothiocyanate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Hadhsc; HCDH; hydroxyacyl-Coenzyme A dehydrogenase; hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; hydroxylacyl-Coenzyme A dehydrogenase; hydroxylacyl-Coenzyme A dehydrogenase short chain; hydroxylacyl-Coenzyme A dehydrogenase, short chain; L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain; medium and short chain L-3-hydroxyacyl-coenzyme A dehydrogenase; medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; short chain 3-hydroxyacyl-CoA dehydrogenase; short-chain 3-hydroxyacyl-CoA dehydrogenase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 222,462,049 - 222,504,446 (-) NCBI GRCr8 mRatBN7.2 2 219,787,935 - 219,830,335 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 219,787,927 - 219,830,353 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 227,444,166 - 227,486,582 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 225,343,838 - 225,386,248 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 220,201,461 - 220,243,878 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 236,353,445 - 236,395,067 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 236,353,445 - 236,395,067 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 254,902,140 - 254,944,001 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 228,698,545 - 228,751,691 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 228,685,284 - 228,738,431 (-) NCBI Celera 2 212,044,254 - 212,086,368 (-) NCBI Celera Cytogenetic Map 2 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hadh Rat (+)-dexrazoxane decreases expression ISO Hadh (Mus musculus) 6480464 Dexrazoxane results in decreased expression of HADH mRNA CTD PMID:26873546 Hadh Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of HADH mRNA] CTD PMID:31150632 Hadh Rat (1->4)-beta-D-glucan multiple interactions ISO Hadh (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of HADH mRNA CTD PMID:36331819 Hadh Rat (R)-adrenaline multiple interactions EXP 6480464 [Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of HADH protein CTD PMID:19464573 Hadh Rat 1,2-dimethylhydrazine multiple interactions ISO Hadh (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of HADH mRNA CTD PMID:22206623 Hadh Rat 1,2-dimethylhydrazine decreases expression ISO Hadh (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of HADH mRNA CTD PMID:22206623 Hadh Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of HADH mRNA CTD PMID:30723492 Hadh Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of HADH mRNA CTD PMID:16174780 Hadh Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of HADH mRNA CTD PMID:26865667 Hadh Rat 17beta-estradiol increases oxidation ISO HADH (Homo sapiens) 6480464 HADH protein results in increased oxidation of Estradiol CTD PMID:10600649 Hadh Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of HADH protein CTD PMID:32145629 Hadh Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of HADH mRNA CTD PMID:26496021 Hadh Rat 17beta-estradiol multiple interactions ISO HADH (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of HADH mRNA CTD PMID:20660070 Hadh Rat 17beta-estradiol decreases expression ISO Hadh (Mus musculus) 6480464 Estradiol results in decreased expression of HADH mRNA CTD PMID:19484750 and PMID:39298647 Hadh Rat 17beta-estradiol increases expression ISO HADH (Homo sapiens) 6480464 Estradiol results in increased expression of HADH mRNA CTD PMID:16474171 and PMID:19167446 Hadh Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO HADH (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Hadh Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Hadh (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of HADH mRNA CTD PMID:16214954 Hadh Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HADH mRNA CTD PMID:21724226 Hadh Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO HADH (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of HADH mRNA CTD PMID:20106945 and PMID:21632981 Hadh Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hadh (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HADH mRNA CTD PMID:17949056 more ... Hadh Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of HADH mRNA CTD PMID:22298810 Hadh Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Hadh (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of HADH mRNA CTD PMID:18796159 and PMID:19933214 Hadh Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Hadh (Mus musculus) 6480464 2 more ... CTD PMID:20702594 Hadh Rat 2,4,6-tribromophenol increases expression ISO HADH (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Hadh Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Hadh (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Hadh Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of HADH mRNA CTD PMID:21346803 Hadh Rat 2,6-dimethoxyphenol multiple interactions ISO HADH (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of HADH protein CTD PMID:38598786 Hadh Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of HADH mRNA CTD PMID:21346803 Hadh Rat 2-methylcholine affects expression ISO HADH (Homo sapiens) 6480464 beta-methylcholine affects the expression of HADH mRNA CTD PMID:21179406 Hadh Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine decreases expression EXP 6480464 Puromycin Aminonucleoside results in decreased expression of HADH protein CTD PMID:19264907 Hadh Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine decreases expression ISO Hadh (Mus musculus) 6480464 Puromycin Aminonucleoside results in decreased expression of HADH protein CTD PMID:19264907 Hadh Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO HADH (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of HADH protein CTD PMID:31675489 Hadh Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of HADH mRNA CTD PMID:28522335 Hadh Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin analog results in decreased expression of HADH protein and alpha-Chlorohydrin results in decreased expression of HADH protein CTD PMID:26597043 and PMID:34915118 Hadh Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Hadh (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased expression of HADH mRNA CTD PMID:23428407 Hadh Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO HADH (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of HADH mRNA CTD PMID:28628672 Hadh Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of HADH mRNA CTD PMID:19162173 Hadh Rat 4,4'-diaminodiphenylmethane increases expression ISO Hadh (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of HADH mRNA CTD PMID:18648102 Hadh Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of HADH mRNA CTD PMID:30723492 Hadh Rat 4,4'-sulfonyldiphenol increases expression ISO HADH (Homo sapiens) 6480464 bisphenol S results in increased expression of HADH protein CTD PMID:34186270 Hadh Rat 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime multiple interactions ISO HADH (Homo sapiens) 6480464 [6-(4-chlorophenyl)imidazo(2 more ... CTD PMID:30611723 Hadh Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of HADH mRNA CTD PMID:24780913 and PMID:30047161 Hadh Rat 7H-xanthine multiple interactions EXP 6480464 [Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of HADH protein and [Xanthine co-treated with XDH protein] results in decreased expression of HADH protein CTD PMID:19464573 Hadh Rat 9H-xanthine multiple interactions EXP 6480464 [Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of HADH protein and [Xanthine co-treated with XDH protein] results in decreased expression of HADH protein CTD PMID:19464573 Hadh Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of HADH mRNA CTD PMID:31881176 Hadh Rat acrolein affects activity EXP 6480464 Acrolein affects the activity of HADH protein CTD PMID:35150775 Hadh Rat acrolein decreases activity EXP 6480464 Acrolein results in decreased activity of HADH protein CTD PMID:36806656 Hadh Rat aflatoxin B1 affects expression ISO HADH (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of HADH protein CTD PMID:20106945 Hadh Rat aflatoxin B1 decreases expression ISO HADH (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of HADH mRNA CTD PMID:27153756 Hadh Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of HADH mRNA CTD PMID:20488242 Hadh Rat all-trans-retinoic acid decreases expression ISO HADH (Homo sapiens) 6480464 Tretinoin results in decreased expression of HADH mRNA CTD PMID:33167477 Hadh Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of HADH mRNA CTD PMID:30047161 Hadh Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HADH mRNA CTD PMID:16483693 Hadh Rat aristolochic acid A increases expression ISO HADH (Homo sapiens) 6480464 aristolochic acid I results in increased expression of HADH protein CTD PMID:33212167 Hadh Rat arsenous acid increases expression ISO Hadh (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of HADH mRNA CTD PMID:30237538 Hadh Rat atrazine decreases expression ISO HADH (Homo sapiens) 6480464 Atrazine results in decreased expression of HADH mRNA CTD PMID:22378314 Hadh Rat azathioprine decreases expression ISO HADH (Homo sapiens) 6480464 Azathioprine results in decreased expression of HADH mRNA CTD PMID:22623647 Hadh Rat benzo[a]pyrene increases expression ISO Hadh (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of HADH mRNA CTD PMID:22228805 Hadh Rat benzo[a]pyrene decreases expression ISO HADH (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of HADH mRNA CTD PMID:32234424 Hadh Rat bis(2-ethylhexyl) phthalate increases expression ISO Hadh (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of HADH mRNA CTD PMID:19850644 Hadh Rat bis(2-ethylhexyl) phthalate decreases expression ISO Hadh (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of HADH mRNA CTD PMID:34319233 and PMID:35550907 Hadh Rat bis(2-ethylhexyl) phthalate increases activity ISO Hadh (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased activity of HADH protein CTD PMID:20123618 Hadh Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Hadh (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of HADH mRNA] CTD PMID:19850644 Hadh Rat bisphenol A increases expression ISO HADH (Homo sapiens) 6480464 bisphenol A results in increased expression of HADH mRNA and bisphenol A results in increased expression of HADH protein CTD PMID:16474171 and PMID:37567409 Hadh Rat bisphenol A decreases expression ISO HADH (Homo sapiens) 6480464 bisphenol A results in decreased expression of HADH protein CTD PMID:31675489 and PMID:34186270 Hadh Rat bisphenol A affects expression ISO HADH (Homo sapiens) 6480464 bisphenol A affects the expression of HADH mRNA CTD PMID:30903817 Hadh Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of HADH gene CTD PMID:28505145 Hadh Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of HADH mRNA CTD PMID:25181051 Hadh Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of HADH mRNA CTD PMID:26496021 Hadh Rat bisphenol AF increases expression ISO HADH (Homo sapiens) 6480464 bisphenol AF results in increased expression of HADH protein CTD PMID:34186270 Hadh Rat Bisphenol B increases expression ISO HADH (Homo sapiens) 6480464 bisphenol B results in increased expression of HADH protein CTD PMID:34186270 Hadh Rat bisphenol F increases expression ISO Hadh (Mus musculus) 6480464 bisphenol F results in increased expression of HADH mRNA CTD PMID:38685157 Hadh Rat bisphenol F increases expression ISO HADH (Homo sapiens) 6480464 bisphenol F results in increased expression of HADH protein CTD PMID:34186270 Hadh Rat cadmium atom increases oxidation ISO Hadh (Mus musculus) 6480464 Cadmium results in increased oxidation of HADH protein CTD PMID:24496640 Hadh Rat cadmium dichloride decreases expression ISO HADH (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of HADH mRNA CTD PMID:38568856 Hadh Rat carbon nanotube decreases expression ISO Hadh (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Hadh Rat carmustine decreases expression ISO HADH (Homo sapiens) 6480464 Carmustine results in decreased expression of HADH mRNA CTD PMID:15980968 Hadh Rat cefaloridine decreases expression EXP 6480464 Cephaloridine results in decreased expression of HADH mRNA CTD PMID:18500788 Hadh Rat CGP 52608 multiple interactions ISO HADH (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to HADH gene] CTD PMID:28238834 Hadh Rat chromium(6+) affects expression ISO Hadh (Mus musculus) 6480464 chromium hexavalent ion affects the expression of HADH mRNA CTD PMID:28472532 Hadh Rat cisplatin increases phosphorylation ISO Hadh (Mus musculus) 6480464 Cisplatin results in increased phosphorylation of HADH protein CTD PMID:22006019 Hadh Rat cisplatin multiple interactions ISO HADH (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of HADH mRNA CTD PMID:27392435 Hadh Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of HADH protein CTD PMID:22023808 Hadh Rat clofibrate multiple interactions ISO Hadh (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of HADH mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of HADH mRNA] CTD PMID:17585979 Hadh Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of HADH mRNA and Clofibrate results in increased expression of HADH protein CTD PMID:16470657 and PMID:18670166 Hadh Rat cobalt dichloride increases expression ISO HADH (Homo sapiens) 6480464 cobaltous chloride results in increased expression of HADH mRNA CTD PMID:19376846 Hadh Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of HADH mRNA CTD PMID:24386269 Hadh Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of HADH mRNA CTD PMID:22465980 Hadh Rat copper atom multiple interactions ISO HADH (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of HADH mRNA CTD PMID:20971185 Hadh Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of HADH mRNA CTD PMID:22465980 Hadh Rat copper(0) multiple interactions ISO HADH (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of HADH mRNA CTD PMID:20971185 Hadh Rat copper(II) sulfate decreases expression ISO HADH (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of HADH mRNA CTD PMID:19549813 Hadh Rat corosolic acid decreases expression ISO HADH (Homo sapiens) 6480464 corosolic acid results in decreased expression of HADH mRNA CTD PMID:37939859 Hadh Rat coumestrol multiple interactions ISO HADH (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Hadh Rat coumestrol increases expression ISO HADH (Homo sapiens) 6480464 Coumestrol results in increased expression of HADH mRNA CTD PMID:19167446 Hadh Rat cyclosporin A decreases expression ISO Hadh (Mus musculus) 6480464 Cyclosporine results in decreased expression of HADH mRNA CTD PMID:19770486 and PMID:23830897 Hadh Rat cyclosporin A increases expression ISO HADH (Homo sapiens) 6480464 Cyclosporine results in increased expression of HADH mRNA CTD PMID:27989131 Hadh Rat cyclosporin A decreases expression ISO HADH (Homo sapiens) 6480464 Cyclosporine results in decreased expression of HADH mRNA CTD PMID:20106945 more ... Hadh Rat cylindrospermopsin decreases expression ISO Hadh (Mus musculus) 6480464 cylindrospermopsin results in decreased expression of HADH mRNA CTD PMID:20936652 Hadh Rat decabromodiphenyl ether increases expression ISO HADH (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of HADH protein CTD PMID:31675489 Hadh Rat dexamethasone multiple interactions ISO Hadh (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased expression of HADH mRNA CTD PMID:23428407 Hadh Rat dexamethasone multiple interactions ISO HADH (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of HADH mRNA CTD PMID:28628672 Hadh Rat dexamethasone increases expression ISO HADH (Homo sapiens) 6480464 Dexamethasone results in increased expression of HADH mRNA CTD PMID:25047013 Hadh Rat dextran sulfate multiple interactions ISO Hadh (Mus musculus) 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of HADH protein] CTD PMID:32272095 Hadh Rat dextran sulfate decreases expression ISO Hadh (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of HADH protein CTD PMID:32272095 Hadh Rat diarsenic trioxide increases expression ISO Hadh (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of HADH mRNA CTD PMID:30237538 Hadh Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of HADH mRNA CTD PMID:21266533 Hadh Rat dibutyl phthalate decreases expression ISO Hadh (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of HADH mRNA CTD PMID:17361019 and PMID:21266533 Hadh Rat dioxygen multiple interactions ISO Hadh (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of HADH mRNA CTD PMID:30529165 Hadh Rat dorsomorphin multiple interactions ISO HADH (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HADH mRNA CTD PMID:27188386 Hadh Rat doxorubicin affects response to substance ISO HADH (Homo sapiens) 6480464 HADH protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Hadh Rat doxorubicin decreases expression ISO HADH (Homo sapiens) 6480464 Doxorubicin results in decreased expression of HADH mRNA CTD PMID:29803840 Hadh Rat doxorubicin decreases expression ISO Hadh (Mus musculus) 6480464 Doxorubicin results in decreased expression of HADH mRNA and Doxorubicin results in decreased expression of HADH protein CTD PMID:26873546 Hadh Rat doxorubicin multiple interactions ISO Hadh (Mus musculus) 6480464 [[MT1 protein co-treated with MT2 protein] affects the susceptibility to Doxorubicin] which affects the expression of HADH mRNA CTD PMID:21040762 Hadh Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of HADH mRNA CTD PMID:29391264 Hadh Rat Enterolactone multiple interactions ISO HADH (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of HADH mRNA CTD PMID:19167446 Hadh Rat enzyme inhibitor multiple interactions ISO HADH (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of HADH protein CTD PMID:23301498 Hadh Rat ethanol increases expression ISO Hadh (Mus musculus) 6480464 Ethanol results in increased expression of HADH mRNA CTD PMID:30319688 Hadh Rat fenamidone increases expression ISO Hadh (Mus musculus) 6480464 fenamidone results in increased expression of HADH mRNA CTD PMID:27029645 Hadh Rat fenofibrate increases expression ISO HADH (Homo sapiens) 6480464 Fenofibrate results in increased expression of HADH mRNA CTD PMID:24752549 Hadh Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of HADH mRNA CTD PMID:30307764 Hadh Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of HADH mRNA CTD PMID:18035473 Hadh Rat flutamide affects expression EXP 6480464 Flutamide affects the expression of HADH mRNA CTD PMID:21525395 Hadh Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of HADH mRNA CTD PMID:24136188 and PMID:24793618 Hadh Rat folic acid multiple interactions ISO Hadh (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of HADH mRNA CTD PMID:22206623 Hadh Rat folic acid decreases expression ISO Hadh (Mus musculus) 6480464 Folic Acid results in decreased expression of HADH mRNA CTD PMID:25629700 Hadh Rat furan decreases expression EXP 6480464 furan results in decreased expression of HADH mRNA CTD PMID:26194646 Hadh Rat furfural multiple interactions ISO HADH (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of HADH protein CTD PMID:38598786 Hadh Rat genistein increases expression ISO HADH (Homo sapiens) 6480464 Genistein results in increased expression of HADH mRNA CTD PMID:16474171 Hadh Rat genistein decreases expression ISO HADH (Homo sapiens) 6480464 Genistein results in decreased expression of HADH mRNA CTD PMID:26865667 Hadh Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of HADH mRNA CTD PMID:22061828 Hadh Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of HADH mRNA CTD PMID:33387578 Hadh Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of HADH mRNA CTD PMID:24136188 Hadh Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of HADH gene CTD PMID:31011160 Hadh Rat GW 4064 multiple interactions ISO HADH (Homo sapiens) 6480464 [GW 4064 co-treated with Oleic Acid] results in decreased expression of HADH mRNA CTD PMID:30611723 Hadh Rat GW 7647 increases expression ISO HADH (Homo sapiens) 6480464 GW 7647 results in increased expression of HADH mRNA CTD PMID:30611723 Hadh Rat indinavir multiple interactions ISO Hadh (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in decreased expression of HADH mRNA CTD PMID:16931933 Hadh Rat indometacin multiple interactions ISO HADH (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of HADH mRNA CTD PMID:28628672 Hadh Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of HADH mRNA CTD PMID:36868495 Hadh Rat inulin multiple interactions ISO Hadh (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of HADH mRNA CTD PMID:36331819 Hadh Rat isotretinoin decreases expression ISO HADH (Homo sapiens) 6480464 Isotretinoin results in decreased expression of HADH mRNA CTD PMID:20436886 Hadh Rat ivermectin decreases expression ISO HADH (Homo sapiens) 6480464 Ivermectin results in decreased expression of HADH protein CTD PMID:32959892 Hadh Rat lamivudine multiple interactions ISO Hadh (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in decreased expression of HADH mRNA more ... CTD PMID:16931933 Hadh Rat menadione affects expression ISO HADH (Homo sapiens) 6480464 Vitamin K 3 affects the expression of HADH mRNA CTD PMID:20044591 Hadh Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of HADH mRNA CTD PMID:30467583 Hadh Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of HADH mRNA CTD PMID:30047161 Hadh Rat microcystin-LR decreases expression ISO Hadh (Mus musculus) 6480464 cyanoginosin LR results in decreased expression of HADH protein CTD PMID:26984711 Hadh Rat milrinone increases expression EXP 6480464 Milrinone results in increased expression of HADH mRNA CTD PMID:22936366 Hadh Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of HADH mRNA CTD PMID:21515302 Hadh Rat NAD zwitterion increases metabolic processing ISO HADH (Homo sapiens) 6480464 HADH protein results in increased metabolism of NAD CTD PMID:10600649 Hadh Rat NAD(+) increases metabolic processing ISO HADH (Homo sapiens) 6480464 HADH protein results in increased metabolism of NAD CTD PMID:10600649 Hadh Rat nickel atom decreases expression ISO HADH (Homo sapiens) 6480464 Nickel results in decreased expression of HADH mRNA CTD PMID:25583101 Hadh Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of HADH mRNA CTD PMID:22110744 Hadh Rat niclosamide decreases expression ISO HADH (Homo sapiens) 6480464 Niclosamide results in decreased expression of HADH mRNA CTD PMID:22576131 Hadh Rat nitric oxide increases expression ISO Hadh (Mus musculus) 6480464 Nitric Oxide deficiency results in increased expression of HADH mRNA CTD PMID:15878706 Hadh Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of HADH mRNA CTD PMID:33484710 Hadh Rat oleic acid multiple interactions ISO HADH (Homo sapiens) 6480464 [6-(4-chlorophenyl)imidazo(2 more ... CTD PMID:30611723 Hadh Rat paracetamol multiple interactions ISO Hadh (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of HADH mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of HADH mRNA] CTD PMID:17585979 Hadh Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of HADH mRNA CTD PMID:33387578 Hadh Rat paracetamol decreases expression ISO HADH (Homo sapiens) 6480464 Acetaminophen results in decreased expression of HADH mRNA CTD PMID:29067470 Hadh Rat paracetamol increases expression ISO Hadh (Mus musculus) 6480464 Acetaminophen results in increased expression of HADH protein CTD PMID:21329376 Hadh Rat paracetamol affects expression ISO Hadh (Mus musculus) 6480464 Acetaminophen affects the expression of HADH mRNA CTD PMID:17562736 Hadh Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of HADH mRNA CTD PMID:32680482 Hadh Rat pentachlorophenol increases expression ISO Hadh (Mus musculus) 6480464 Pentachlorophenol results in increased expression of HADH mRNA CTD PMID:23892564 Hadh Rat perfluorooctane-1-sulfonic acid affects expression ISO Hadh (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of HADH mRNA CTD PMID:19429403 Hadh Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Hadh (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of HADH mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of HADH mRNA CTD PMID:36331819 Hadh Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of HADH mRNA CTD PMID:18692542 Hadh Rat perfluorooctanoic acid affects expression ISO Hadh (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of HADH mRNA CTD PMID:19429403 Hadh Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of HADH mRNA CTD PMID:28511854 Hadh Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of HADH mRNA CTD PMID:33945839 Hadh Rat pirinixic acid multiple interactions ISO Hadh (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of HADH mRNA and PPARA protein affects the reaction [pirinixic acid results in increased expression of HADH mRNA] CTD PMID:15777286 and PMID:19710929 Hadh Rat pirinixic acid increases expression ISO Hadh (Mus musculus) 6480464 pirinixic acid results in increased expression of HADH mRNA CTD PMID:15375163 more ... Hadh Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of HADH mRNA CTD PMID:19162173 Hadh Rat pirinixic acid decreases expression ISO Hadh (Mus musculus) 6480464 pirinixic acid results in decreased expression of HADH protein CTD PMID:15226431 Hadh Rat pravastatin decreases expression ISO Hadh (Mus musculus) 6480464 Pravastatin results in decreased expression of HADH mRNA CTD PMID:27225895 Hadh Rat pravastatin decreases expression EXP 6480464 Pravastatin results in decreased expression of HADH mRNA CTD PMID:27225895 Hadh Rat progesterone multiple interactions ISO HADH (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of HADH mRNA CTD PMID:20660070 Hadh Rat propan-2-ol increases metabolic processing ISO HADH (Homo sapiens) 6480464 HADH protein results in increased metabolism of 2-Propanol CTD PMID:10600649 Hadh Rat resveratrol multiple interactions ISO HADH (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of HADH mRNA CTD PMID:19167446 Hadh Rat S-butyl-DL-homocysteine (S,R)-sulfoximine increases expression ISO Hadh (Mus musculus) 6480464 Buthionine Sulfoximine results in increased expression of HADH mRNA CTD PMID:15878706 Hadh Rat saquinavir multiple interactions ISO Hadh (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine co-treated with Saquinavir] results in decreased expression of HADH mRNA CTD PMID:16931933 Hadh Rat SB 431542 multiple interactions ISO HADH (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Hadh Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of HADH protein CTD PMID:29459688 Hadh Rat sodium arsenite multiple interactions ISO HADH (Homo sapiens) 6480464 sodium arsenite promotes the reaction [HADH protein binds to CAPRIN1 protein] CTD PMID:33939924 Hadh Rat sodium arsenite decreases expression ISO HADH (Homo sapiens) 6480464 sodium arsenite results in decreased expression of HADH mRNA CTD PMID:38568856 Hadh Rat sodium fluoride decreases expression ISO Hadh (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of HADH protein CTD PMID:27548804 Hadh Rat Soman increases expression EXP 6480464 Soman results in increased expression of HADH mRNA CTD PMID:19281266 Hadh Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of HADH mRNA CTD PMID:30047161 Hadh Rat tauroursodeoxycholic acid decreases expression EXP 6480464 ursodoxicoltaurine results in decreased expression of HADH mRNA CTD PMID:15885361 Hadh Rat temozolomide decreases expression ISO HADH (Homo sapiens) 6480464 Temozolomide results in decreased expression of HADH mRNA CTD PMID:31758290 Hadh Rat tert-butyl hydroperoxide decreases expression ISO HADH (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of HADH mRNA CTD PMID:15336504 Hadh Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of HADH mRNA CTD PMID:21515302 Hadh Rat testosterone decreases expression ISO HADH (Homo sapiens) 6480464 Testosterone results in decreased expression of HADH mRNA CTD PMID:33359661 Hadh Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of HADH mRNA CTD PMID:31150632 Hadh Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of HADH mRNA] CTD PMID:31150632 Hadh Rat tetrachloromethane decreases expression ISO Hadh (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of HADH mRNA CTD PMID:27339419 and PMID:31919559 Hadh Rat tetracycline decreases expression ISO Hadh (Mus musculus) 6480464 Tetracycline results in decreased expression of HADH mRNA CTD PMID:24489787 Hadh Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of HADH protein CTD PMID:35544339 Hadh Rat theophylline decreases expression ISO HADH (Homo sapiens) 6480464 Theophylline results in decreased expression of HADH mRNA CTD PMID:16083514 Hadh Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of HADH mRNA CTD PMID:16337175 and PMID:34492290 Hadh Rat thiram decreases expression ISO HADH (Homo sapiens) 6480464 Thiram results in decreased expression of HADH mRNA CTD PMID:38568856 Hadh Rat titanium dioxide increases expression ISO Hadh (Mus musculus) 6480464 titanium dioxide results in increased expression of HADH mRNA CTD PMID:23557971 Hadh Rat titanium dioxide decreases methylation ISO Hadh (Mus musculus) 6480464 titanium dioxide results in decreased methylation of HADH gene CTD PMID:35295148 Hadh Rat titanium dioxide increases methylation ISO Hadh (Mus musculus) 6480464 titanium dioxide results in increased methylation of HADH promoter CTD PMID:35295148 Hadh Rat topotecan affects response to substance ISO HADH (Homo sapiens) 6480464 HADH protein affects the susceptibility to Topotecan CTD PMID:16217747 Hadh Rat tributylstannane increases expression ISO Hadh (Mus musculus) 6480464 tributyltin results in increased expression of HADH mRNA CTD PMID:23428407 Hadh Rat Tributyltin oxide decreases expression EXP 6480464 bis(tri-n-butyltin)oxide results in decreased expression of HADH mRNA CTD PMID:17553608 Hadh Rat triphenyl phosphate affects expression ISO HADH (Homo sapiens) 6480464 triphenyl phosphate affects the expression of HADH mRNA CTD PMID:37042841 Hadh Rat triptonide decreases expression ISO Hadh (Mus musculus) 6480464 triptonide results in decreased expression of HADH mRNA CTD PMID:33045310 Hadh Rat troglitazone increases expression ISO Hadh (Mus musculus) 6480464 troglitazone results in increased expression of HADH protein CTD PMID:18495193 Hadh Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of HADH mRNA CTD PMID:21515302 Hadh Rat tunicamycin decreases expression ISO HADH (Homo sapiens) 6480464 Tunicamycin results in decreased expression of HADH mRNA CTD PMID:22378314 Hadh Rat uranium atom affects expression ISO HADH (Homo sapiens) 6480464 Uranium affects the expression of HADH mRNA CTD PMID:15672453 Hadh Rat valproic acid affects expression ISO HADH (Homo sapiens) 6480464 Valproic Acid affects the expression of HADH mRNA CTD PMID:25979313 Hadh Rat valproic acid multiple interactions ISO HADH (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HADH mRNA CTD PMID:27188386 Hadh Rat valproic acid increases expression ISO HADH (Homo sapiens) 6480464 Valproic Acid results in increased expression of HADH mRNA CTD PMID:23179753 and PMID:26272509 Hadh Rat vincaleukoblastine affects response to substance ISO HADH (Homo sapiens) 6480464 HADH protein affects the susceptibility to Vinblastine CTD PMID:16217747 Hadh Rat zaragozic acid A increases expression EXP 6480464 squalestatin 1 results in increased expression of HADH mRNA CTD PMID:27225895 Hadh Rat zaragozic acid A affects expression ISO Hadh (Mus musculus) 6480464 squalestatin 1 affects the expression of HADH mRNA CTD PMID:27225895 Hadh Rat zidovudine multiple interactions ISO Hadh (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in decreased expression of HADH mRNA more ... CTD PMID:16931933 Hadh Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of HADH protein CTD PMID:15671213 Hadh Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of HADH protein CTD PMID:15671213
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-dexrazoxane (ISO) (+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) (R)-adrenaline (EXP) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4,6-tribromophenol (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP,ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO) 6-propyl-2-thiouracil (EXP) 7H-xanthine (EXP) 9H-xanthine (EXP) acetamide (EXP) acrolein (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsenous acid (ISO) atrazine (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) carmustine (ISO) cefaloridine (EXP) CGP 52608 (ISO) chromium(6+) (ISO) cisplatin (EXP,ISO) clofibrate (EXP,ISO) cobalt dichloride (EXP,ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) corosolic acid (ISO) coumestrol (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) Enterolactone (ISO) enzyme inhibitor (ISO) ethanol (ISO) fenamidone (ISO) fenofibrate (ISO) fenvalerate (EXP) flavonoids (EXP) flutamide (EXP) folic acid (ISO) furan (EXP) furfural (ISO) genistein (ISO) gentamycin (EXP) glafenine (EXP) glyphosate (EXP) GW 4064 (ISO) GW 7647 (ISO) indinavir (ISO) indometacin (EXP,ISO) inulin (ISO) isotretinoin (ISO) ivermectin (ISO) lamivudine (ISO) menadione (ISO) methapyrilene (EXP) methimazole (EXP) microcystin-LR (ISO) milrinone (EXP) Muraglitazar (EXP) NAD zwitterion (ISO) NAD(+) (ISO) nickel atom (ISO) nickel dichloride (EXP) niclosamide (ISO) nitric oxide (ISO) nitrofen (EXP) oleic acid (ISO) paracetamol (EXP,ISO) paraquat (EXP) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP,ISO) PhIP (EXP) pirinixic acid (EXP,ISO) pravastatin (EXP,ISO) progesterone (ISO) propan-2-ol (ISO) resveratrol (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) saquinavir (ISO) SB 431542 (ISO) sodium arsenite (EXP,ISO) sodium fluoride (ISO) Soman (EXP) sulfadimethoxine (EXP) tauroursodeoxycholic acid (EXP) temozolomide (ISO) tert-butyl hydroperoxide (ISO) Tesaglitazar (EXP) testosterone (ISO) tetrachloromethane (EXP,ISO) tetracycline (ISO) thapsigargin (EXP) theophylline (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (ISO) tributylstannane (ISO) Tributyltin oxide (EXP) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (EXP,ISO) tunicamycin (ISO) uranium atom (ISO) valproic acid (ISO) vincaleukoblastine (ISO) zaragozic acid A (EXP,ISO) zidovudine (ISO) zinc atom (EXP) zinc(0) (EXP)
Molecular Function
3-hydroxyacyl-CoA dehydrogenase activity (IBA,IEA,IMP,ISO,ISS) identical protein binding (IEA,ISO,ISS) NAD+ binding (IEA,ISO,ISS) oxidoreductase activity (IEA) oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (IEA) protein binding (ISO)
1.
High intensity training-induced changes in skeletal muscle antioxidant enzyme activity.
Criswell D, etal., Med Sci Sports Exerc. 1993 Oct;25(10):1135-40.
2.
Different forms of obesity as a function of diet composition.
Dourmashkin JT, etal., Int J Obes (Lond). 2005 Nov;29(11):1368-78.
3.
Fenofibrate improves insulin sensitivity in connection with intramuscular lipid content, muscle fatty acid-binding protein, and beta-oxidation in skeletal muscle.
Furuhashi M, etal., J Endocrinol. 2002 Aug;174(2):321-9.
4.
Purification and properties of 3-hydroxyacyl coenzyme A dehydrogenase-binding protein from rat liver mitochondria.
Furuta S and Hashimoto T, J Biochem. 1995 Oct;118(4):810-8.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Identity of heart and liver L-3-hydroxyacyl coenzyme A dehydrogenase.
He XY, etal., Biochim Biophys Acta 1999 Feb 25;1437(2):119-23.
8.
Serial evaluation of fatty acid metabolism in rats with myocardial infarction by pinhole SPECT.
Hirai T, etal., J Nucl Cardiol. 2001 Jul-Aug;8(4):472-81.
9.
Effects of streptozotocin diabetes, insulin treatment, and training on the diaphragm.
Ianuzzo CD, etal., J Appl Physiol. 1982 Jun;52(6):1471-5.
10.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
11.
Specificity in beta cell expression of L-3-hydroxyacyl-CoA dehydrogenase, short chain, and potential role in down-regulating insulin release.
Martens GA, etal., J Biol Chem. 2007 Jul 20;282(29):21134-44. Epub 2007 May 9.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Familial hyperinsulinemic hypoglycemia caused by a defect in the SCHAD enzyme of mitochondrial fatty acid oxidation.
Molven A, etal., Diabetes. 2004 Jan;53(1):221-7.
14.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
16.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
17.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
18.
GOA pipeline
RGD automated data pipeline
19.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
20.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
21.
Role of medium- and short-chain L-3-hydroxyacyl-CoA dehydrogenase in the regulation of body weight and thermogenesis.
Schulz N, etal., Endocrinology. 2011 Dec;152(12):4641-51. doi: 10.1210/en.2011-1547. Epub 2011 Oct 11.
22.
Growth hormone and heart failure: oxidative stress and energetic metabolism in rats.
Seiva FR, etal., Growth Horm IGF Res. 2008 Aug;18(4):275-83. Epub 2008 Jan 10.
23.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Hadh Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 222,462,049 - 222,504,446 (-) NCBI GRCr8 mRatBN7.2 2 219,787,935 - 219,830,335 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 219,787,927 - 219,830,353 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 227,444,166 - 227,486,582 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 225,343,838 - 225,386,248 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 220,201,461 - 220,243,878 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 236,353,445 - 236,395,067 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 236,353,445 - 236,395,067 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 254,902,140 - 254,944,001 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 228,698,545 - 228,751,691 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 228,685,284 - 228,738,431 (-) NCBI Celera 2 212,044,254 - 212,086,368 (-) NCBI Celera Cytogenetic Map 2 q43 NCBI
HADH Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 107,989,889 - 108,035,171 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 107,989,714 - 108,035,241 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 108,911,045 - 108,956,327 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 109,130,389 - 109,175,780 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 4 106,205,689 - 106,251,144 (+) NCBI Celera Cytogenetic Map 4 q25 NCBI HuRef 4 104,642,283 - 104,687,973 (+) NCBI HuRef CHM1_1 4 108,887,327 - 108,932,780 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 111,292,223 - 111,337,508 (+) NCBI T2T-CHM13v2.0
Hadh Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 131,027,068 - 131,065,750 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 131,027,068 - 131,065,750 (-) Ensembl GRCm39 Ensembl GRCm38 3 131,233,419 - 131,272,101 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 131,233,419 - 131,272,101 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 130,936,342 - 130,974,955 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 131,222,610 - 131,261,182 (-) NCBI MGSCv36 mm8 Celera 3 137,754,696 - 137,793,253 (-) NCBI Celera Cytogenetic Map 3 G3 NCBI cM Map 3 60.86 NCBI
Hadh Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955496 1,835,034 - 1,861,407 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955496 1,835,034 - 1,861,410 (-) NCBI ChiLan1.0 ChiLan1.0
HADH Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 106,088,578 - 106,133,957 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 106,383,480 - 106,428,851 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 100,495,205 - 100,540,589 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 111,067,537 - 111,112,945 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 111,067,336 - 111,113,868 (+) Ensembl panpan1.1 panPan2
HADH Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 28,460,445 - 28,506,141 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 28,460,193 - 28,531,280 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 13,516,288 - 13,562,132 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 28,689,480 - 28,735,351 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 28,689,484 - 28,780,497 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 28,682,743 - 28,728,360 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 28,427,283 - 28,473,178 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 11,383,587 - 11,429,427 (-) NCBI UU_Cfam_GSD_1.0
Hadh
HADH Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 113,950,034 - 114,005,511 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 113,952,561 - 114,005,510 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 122,212,898 - 122,265,850 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HADH Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 55,919,499 - 55,965,074 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 55,919,623 - 55,964,857 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 34,546,087 - 34,591,597 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hadh
.
Predicted Target Of
Count of predictions: 73 Count of miRNA genes: 57 Interacting mature miRNAs: 65 Transcripts: ENSRNOT00000014658 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 2301408 Kidm36 Kidney mass QTL 36 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 190613715 226808892 Rat 1598813 Memor9 Memory QTL 9 2.7 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 199341726 234244620 Rat 8693697 Alc36 Alcohol consumption QTL 36 2 0.592 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 2 217139753 236660713 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 1298075 Scl17 Serum cholesterol level QTL 17 3.4 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 211744537 249053267 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 2298479 Eau5 Experimental allergic uveoretinitis QTL 5 0.0021 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 2 202446871 237938339 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 1300126 Bp175 Blood pressure QTL 175 3.46 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 214226044 247136170 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 7207484 Bss108 Bone structure and strength QTL 108 5.3 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 2 211744537 249053267 Rat 2313073 Bmd75 Bone mineral density QTL 75 4.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 2 215377404 237938339 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 184165752 229165752 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 7207482 Bss107 Bone structure and strength QTL 107 7 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 2 211744537 249053267 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 2317752 Glom23 Glomerulus QTL 23 3.6 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 2 193452645 245889826 Rat 1549836 Bss2 Bone structure and strength QTL 2 7.5 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 2 211744537 249053267 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 2317885 Alcrsp28 Alcohol response QTL 28 2.1 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 212828222 249053267 Rat 1581499 Esta2 Estrogen-induced thymic atrophy QTL 2 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 189599258 226936289 Rat 1331767 Hrtrt12 Heart rate QTL 12 3.373 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 218414747 240841241 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 2293833 Kiddil8 Kidney dilation QTL 8 2.9 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 219753301 247136170 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 1598835 Anxrr18 Anxiety related response QTL 18 2.98 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 2 200990457 245990457 Rat 7207490 Bss111 Bone structure and strength QTL 111 6.4 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 2 211744537 249053267 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 2293844 Kiddil7 Kidney dilation QTL 7 3.5 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 219753301 247136170 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 2299161 Iddm33 Insulin dependent diabetes mellitus QTL 33 2.98 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 206312063 220876787 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 1359019 Hrtrt19 Heart rate QTL 19 2.9 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 219753301 226277316 Rat
RH130220
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 219,787,950 - 219,788,156 (+) MAPPER mRatBN7.2 Rnor_6.0 2 234,628,608 - 234,628,813 NCBI Rnor6.0 Rnor_6.0 2 236,353,461 - 236,353,666 NCBI Rnor6.0 Rnor_5.0 2 254,902,156 - 254,902,361 UniSTS Rnor5.0 Rnor_5.0 2 253,948,833 - 253,949,038 UniSTS Rnor5.0 RGSC_v3.4 2 228,698,561 - 228,698,766 UniSTS RGSC3.4 Celera 2 212,044,270 - 212,044,475 UniSTS RH 3.4 Map 2 1547.5 UniSTS Cytogenetic Map 2 q43 UniSTS
RH143628
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 219,830,486 - 219,830,588 (+) MAPPER mRatBN7.2 Rnor_6.0 2 236,395,219 - 236,395,320 NCBI Rnor6.0 Rnor_5.0 2 254,944,153 - 254,944,254 UniSTS Rnor5.0 RGSC_v3.4 2 228,751,843 - 228,751,944 UniSTS RGSC3.4 Celera 2 212,086,520 - 212,086,621 UniSTS RH 3.4 Map 2 1549.1 UniSTS Cytogenetic Map 2 q43 UniSTS
RH137095
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 219,788,003 - 219,788,190 (+) MAPPER mRatBN7.2 Rnor_6.0 2 234,628,661 - 234,628,847 NCBI Rnor6.0 Rnor_6.0 2 236,353,514 - 236,353,700 NCBI Rnor6.0 Rnor_5.0 2 254,902,209 - 254,902,395 UniSTS Rnor5.0 Rnor_5.0 2 253,948,886 - 253,949,072 UniSTS Rnor5.0 RGSC_v3.4 2 228,698,614 - 228,698,800 UniSTS RGSC3.4 Celera 2 212,044,323 - 212,044,509 UniSTS RH 3.4 Map 2 1549.4 UniSTS Cytogenetic Map 2 q43 UniSTS
BQ195950
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 219,813,422 - 219,813,610 (+) MAPPER mRatBN7.2 Rnor_6.0 2 236,378,932 - 236,379,119 NCBI Rnor6.0 Rnor_5.0 2 254,927,627 - 254,927,814 UniSTS Rnor5.0 RGSC_v3.4 2 228,724,032 - 228,724,219 UniSTS RGSC3.4 Celera 2 212,069,769 - 212,069,956 UniSTS RH 3.4 Map 2 1547.5 UniSTS Cytogenetic Map 2 q43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014658 ⟹ ENSRNOP00000014658
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 219,787,927 - 219,830,353 (-) Ensembl Rnor_6.0 Ensembl 2 236,353,445 - 236,395,067 (-) Ensembl
RefSeq Acc Id:
NM_057186 ⟹ NP_476534
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 222,462,049 - 222,504,446 (-) NCBI mRatBN7.2 2 219,787,935 - 219,830,335 (-) NCBI Rnor_6.0 2 236,353,445 - 236,395,067 (-) NCBI Rnor_5.0 2 254,902,140 - 254,944,001 (-) NCBI RGSC_v3.4 2 228,698,545 - 228,751,691 (-) RGD Celera 2 212,044,254 - 212,086,368 (-) RGD
Sequence:
TGCTGGTTCTCGGCTGCTCCACTGAGCTATGGCGTTCGTGACCAGGCAATTCGTGCGCTCCATGTCCTCCTCTTCCTCTGCGTCGGCGGCCGCCAAGAAGATCCTGATCAAGCATGTGACGGTCATCG
hide sequence
RefSeq Acc Id:
NP_476534 ⟸ NM_057186
- Peptide Label:
precursor
- UniProtKB:
Q9WVK7 (UniProtKB/Swiss-Prot), A6HVS6 (UniProtKB/TrEMBL)
- Sequence:
MAFVTRQFVRSMSSSSSASAAAKKILIKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLKRMAKKKFTENPKAADEFVEKTLSSLSTSTDAASVVHSTDLVVEAIVENLKLKN
hide sequence
Ensembl Acc Id:
ENSRNOP00000014658 ⟸ ENSRNOT00000014658
RGD ID: 13691760 Promoter ID: EPDNEW_R2283 Type: initiation region Name: Hadh_1 Description: hydroxyacyl-CoA dehydrogenase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 236,395,059 - 236,395,119 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-02
Hadh
hydroxyacyl-CoA dehydrogenase
Hadh
hydroxyacyl-Coenzyme A dehydrogenase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-18
Hadh
hydroxyacyl-Coenzyme A dehydrogenase
Hadhsc
L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Hadhsc
L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
expressed in heart and liver
68799
