Advanced Search (OLGA)

Gene: Gnb2 (G protein subunit beta 2) Rattus norvegicus

Analyze

Symbol:

Gnb2

Name:

G protein subunit beta 2

RGD ID:

69319

Description:

Enables calcium channel regulator activity. Predicted to be involved in G protein-coupled receptor signaling pathway and regulation of potassium ion transmembrane transport. Located in cell body. Part of protein-containing complex. Is active in parallel fiber to Purkinje cell synapse and synaptic vesicle membrane. Orthologous to human GNB2 (G protein subunit beta 2); PARTICIPATES IN chemokine mediated signaling pathway; glutamate signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

g protein subunit beta-2; guanine nucleotide binding protein (G protein), beta 2; guanine nucleotide binding protein (G protein), beta polypeptide 2; guanine nucleotide binding protein beta 2; guanine nucleotide binding protein beta 2 subunit; guanine nucleotide binding protein, beta 2; guanine nucleotide binding protein, beta polypeptide 2; guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2; guanine nucleotide-binding protein, beta 2; heterotrimeric guanine nucleotide-binding protein 2c1; Hg2c1; transducin beta chain 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNB2 (G protein subunit beta 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gnb2 (guanine nucleotide binding protein (G protein), beta 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gnb2 (G protein subunit beta 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNB2 (G protein subunit beta 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNB2 (G protein subunit beta 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gnb2 (G protein subunit beta 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNB2 (G protein subunit beta 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GNB2 (G protein subunit beta 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gnb2 (G protein subunit beta 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gnb2 (G protein subunit beta 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GNB4 (G protein subunit beta 4)	HGNC	OrthoDB
Homo sapiens (human):	POLR1D (RNA polymerase I and III subunit D)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GNB2 (G protein subunit beta 2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gnb2 (guanine nucleotide binding protein (G protein), beta 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gnb2 (guanine nucleotide binding protein (G protein), beta polypeptide 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gnb2 (guanine nucleotide binding protein (G protein), beta polypeptide 2)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gpb-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Gbeta13F	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	STE4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	STE4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	24,795,505 - 24,800,796 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	24,795,827 - 24,800,796 (+)	Ensembl				GRCr8
mRatBN7.2	12	19,159,002 - 19,164,021 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	19,158,973 - 19,164,019 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	20,315,269 - 20,320,289 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	20,928,193 - 20,933,213 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	19,992,543 - 19,997,563 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	22,229,079 - 22,234,096 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	22,229,079 - 22,234,096 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	24,245,847 - 24,250,864 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	19,597,312 - 19,602,329 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	20,964,068 - 20,969,085 (+)	NCBI		Celera
RGSC_v3.1	12	19,586,873 - 19,591,891 (-)	NCBI
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Developmental Disabilities (ISO)

genetic disease (ISO)

NEURODEVELOPMENTAL DISORDER WITH HYPOTONIA AND DYSMORPHIC FACIES (ISO)

Sick Sinus Syndrome 4 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R)-adrenaline (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dimethoxyphenol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxynon-2-enal (ISO)

5-fluorouracil (ISO)

acetylsalicylic acid (ISO)

acrolein (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

atrazine (ISO)

barium(0) (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (EXP,ISO)

C60 fullerene (EXP)

cadmium dichloride (ISO)

cannabidiol (EXP)

chlorpyrifos (ISO)

choline (ISO)

clobetasol (ISO)

clofibrate (ISO)

cocaine (EXP)

dibenzo[a,l]pyrene (ISO)

diethylstilbestrol (EXP)

dioxygen (ISO)

elemental selenium (ISO)

ethanol (EXP,ISO)

ethyl methanesulfonate (ISO)

fenvalerate (EXP)

fluoxetine (ISO)

folic acid (ISO)

FR900359 (ISO)

furfural (ISO)

gefitinib (ISO)

genistein (ISO)

hyaluronic acid (EXP)

hydrogen peroxide (EXP,ISO)

hypochlorous acid (ISO)

ivermectin (ISO)

L-methionine (ISO)

lidocaine (EXP)

methamphetamine (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

nitrates (ISO)

Nor-9-carboxy-delta9-THC (ISO)

ozone (ISO)

paracetamol (ISO)

potassium dichromate (ISO)

rotenone (EXP)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sodium fluoride (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

undecane (EXP)

valproic acid (ISO)

vinclozolin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G protein-coupled receptor signaling pathway (IBA)

regulation of potassium ion transmembrane transport (IEA,ISO,ISS)

signal transduction (IEA)

Cellular Component

cell body (IDA)

cytoplasm (IBA)

heterotrimeric G-protein complex (IBA)

parallel fiber to Purkinje cell synapse (IDA)

perinuclear region of cytoplasm (IEA,ISO,ISS)

plasma membrane (IEA,ISO,ISS)

protein-containing complex (IDA)

synapse (IEA,ISO)

synaptic vesicle membrane (IDA)

Molecular Function

calcium channel regulator activity (IMP)

GTPase binding (IEA,ISO)

protein binding (ISO)

protein-containing complex binding (IEA,ISO)

signaling receptor complex adaptor activity (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

glutamate signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Differential modulation of N-type 1B and P/Q-type 1A calcium channels by different G protein subunit isoforms.	Arnot MI, etal., J Physiol 2000 Sep 1;527 Pt 2:203-12.
2.	Distribution of heterotrimeric G-protein beta and gamma subunits in the rat brain.	Betty M, etal., Neuroscience 1998 Jul;85(2):475-86.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	Immunohistochemical localization of G protein beta1, beta2, beta3, beta4, beta5, and gamma3 subunits in the adult rat brain.	Liang JJ, etal., J Neurochem. 1998 Jul;71(1):345-55.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	Functional G-protein heterotrimers are associated with vesicles of putative glutamatergic terminals: implications for regulation of transmitter uptake.	Pahner I, etal., Mol Cell Neurosci. 2003 Jul;23(3):398-413. doi: 10.1016/s1044-7431(03)00059-9.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.	Gbetagamma that interacts with adenylyl cyclase in opioid tolerance originates from a Gs protein.	Wang HY and Burns LH, J Neurobiol. 2006 Oct;66(12):1302-10.

Additional References at PubMed

PMID:15489334	PMID:16498633	PMID:16502470	PMID:17634366	PMID:17897319	PMID:19190083	PMID:19199708	PMID:19255495	PMID:19946888	PMID:20458337	PMID:21423176	PMID:21633701
PMID:22120110	PMID:22711958	PMID:22905384	PMID:23209302	PMID:23376485	PMID:23533145	PMID:24513289	PMID:24625528	PMID:28131823	PMID:35352799	PMID:35659652

Genomics

Comparative Map Data

Gnb2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	24,795,505 - 24,800,796 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	24,795,827 - 24,800,796 (+)	Ensembl				GRCr8
mRatBN7.2	12	19,159,002 - 19,164,021 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	19,158,973 - 19,164,019 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	20,315,269 - 20,320,289 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	20,928,193 - 20,933,213 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	19,992,543 - 19,997,563 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	22,229,079 - 22,234,096 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	22,229,079 - 22,234,096 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	24,245,847 - 24,250,864 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	19,597,312 - 19,602,329 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	20,964,068 - 20,969,085 (+)	NCBI		Celera
RGSC_v3.1	12	19,586,873 - 19,591,891 (-)	NCBI
Cytogenetic Map	12	q12	NCBI

GNB2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	100,673,740 - 100,679,169 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	100,673,567 - 100,679,174 (+)	Ensembl			hg38	GRCh38
GRCh37	7	100,271,363 - 100,276,792 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	100,109,311 - 100,114,728 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	99,916,025 - 99,921,442	NCBI
Celera	7	95,001,927 - 95,007,353 (+)	NCBI		Celera
Cytogenetic Map	7	q22.1	NCBI
HuRef	7	94,902,070 - 94,907,496 (+)	NCBI		HuRef
CHM1_1	7	100,201,871 - 100,207,297 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	101,913,819 - 101,919,248 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	99,630,968 - 99,636,397 (+)	NCBI

Gnb2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	137,526,389 - 137,533,085 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	137,526,389 - 137,531,772 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	137,528,127 - 137,533,449 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	137,528,127 - 137,533,510 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	137,969,357 - 137,974,457 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	137,757,917 - 137,763,017 (-)	NCBI		MGSCv36	mm8
Celera	5	134,511,768 - 134,516,867 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	76.54	NCBI

Gnb2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955573	241,854 - 247,849 (-)	Ensembl
ChiLan1.0	NW_004955573	242,815 - 247,740 (-)	NCBI	ChiLan1.0	ChiLan1.0

GNB2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	118,585,659 - 118,591,092 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	166,850,298 - 166,855,723 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	92,700,807 - 92,706,211 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	106,104,339 - 106,107,270 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	106,104,339 - 106,107,270 (+)	Ensembl			panPan2	panpan1.1

GNB2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	9,032,536 - 9,037,734 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	9,032,811 - 9,037,668 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	10,736,967 - 10,742,162 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	8,966,708 - 8,971,903 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	8,966,710 - 8,971,917 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	8,819,250 - 8,824,439 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	8,796,973 - 8,802,181 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	8,979,149 - 8,984,345 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gnb2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	133,326,473 - 133,329,113 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	706,505 - 714,462 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	706,505 - 710,057 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNB2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	8,579,122 - 8,584,266 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	8,579,037 - 8,585,268 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	7,974,039 - 7,979,398 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GNB2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	12,533,667 - 12,539,060 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	12,533,659 - 12,536,570 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666070	3,766,511 - 3,772,471 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gnb2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	16,419,165 - 16,424,935 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	16,421,372 - 16,426,408 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gnb2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	16,485,254 - 16,490,298 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gnb2
44 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	88
Count of miRNA genes:	60
Interacting mature miRNAs:	77
Transcripts:	ENSRNOT00000001911
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312418	Kidm41	Kidney mass QTL 41	3.7	0.0001	kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	12	5921918	25247790	Rat
61443	Btemp2	Thermal response to stress QTL 2	3.3	0.000094	body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	12	20139028	26430640	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	1	29775522	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28133365	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	12233000	30490641	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1300174	Bw15	Body weight QTL 15	2.93		body mass (VT:0001259)	body weight loss (CMO:0001399)	12	1	28606299	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	18749469	36488809	Rat
7204484	Bp358	Blood pressure QTL 358		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	1	24849755	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	18749469	34312613	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303568	Bw88	Body weight QTL 88	3		body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28606299	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	33700556	Rat

Markers in Region

Gnb2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	24,799,759 - 24,800,236 (+)	Marker Load Pipeline
mRatBN7.2	12	19,162,982 - 19,163,459 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	22,233,060 - 22,233,536	NCBI	Rnor6.0
Rnor_5.0	12	24,249,828 - 24,250,304	UniSTS	Rnor5.0
RGSC_v3.4	12	19,597,872 - 19,598,348	UniSTS	RGSC3.4
Celera	12	20,968,049 - 20,968,525	UniSTS
Cytogenetic Map	12	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031037	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089799	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089800	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271695	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF022084	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF277892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF397193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC065579	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120485	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120486	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209560	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	OU667101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U34959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001911 ⟹ ENSRNOP00000001911

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	24,795,827 - 24,800,795 (+)	Ensembl
mRatBN7.2 Ensembl	12	19,158,973 - 19,164,017 (+)	Ensembl
Rnor_6.0 Ensembl	12	22,229,079 - 22,234,096 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097367 ⟹ ENSRNOP00000079960

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	24,798,360 - 24,800,796 (+)	Ensembl
mRatBN7.2 Ensembl	12	19,160,627 - 19,164,019 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099940 ⟹ ENSRNOP00000079986

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	19,159,032 - 19,164,019 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100577 ⟹ ENSRNOP00000078220

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	24,795,827 - 24,800,795 (+)	Ensembl
mRatBN7.2 Ensembl	12	19,158,973 - 19,164,017 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116394 ⟹ ENSRNOP00000097429

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	24,795,827 - 24,800,795 (+)	Ensembl
mRatBN7.2 Ensembl	12	19,158,973 - 19,164,017 (+)	Ensembl

RefSeq Acc Id:

NM_031037 ⟹ NP_112299

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	24,795,779 - 24,800,796 (+)	NCBI
mRatBN7.2	12	19,159,002 - 19,164,019 (+)	NCBI
Rnor_6.0	12	22,229,079 - 22,234,096 (+)	NCBI
Rnor_5.0	12	24,245,847 - 24,250,864 (+)	NCBI
RGSC_v3.4	12	19,597,312 - 19,602,329 (-)	RGD
Celera	12	20,964,068 - 20,969,085 (+)	RGD

Sequence:

show sequence

GAGAGCTGCGCTGGACGGTTGAGTTGGGGTGACTGAGGAAATCCATCCGCGTCGCCGCCGCTGC
CGCCTCCGCCGCGGAGGAAGACAGGACCTCCCGCGCTCCTCCAAGCGACCCCTTGGCAGAGTCC
CACCACCTCAGGCCTCGGGCCAGCGGCCAGGAGCTGCCTCCCCCAGCCCCCGTCCCGCGGCCCC
CAGCCGCCCCCAACCCCGCCCCACGGGCCCGGCGCCATGAGTGAGCTGGAGCAACTGAGACAGG
AGGCTGAGCAGCTCCGGAACCAGATCCGGGACGCCAGAAAAGCATGCGGGGATTCCACACTGAC
CCAGATCACAGCTGGGCTGGACCCAGTGGGGCGAATTCAGATGAGAACACGGAGGACCCTCCGT
GGACACCTGGCAAAAATCTATGCCATGCACTGGGGGACAGACTCAAGGCTGCTGGTCAGCGCCT
CCCAGGACGGAAAGCTCATCATTTGGGACAGCTACACCACTAACAAGGTCCACGCCATCCCTCT
GCGCTCCTCCTGGGTCATGACCTGTGCCTACGCCCCCTCGGGGAACTTCGTGGCCTGTGGGGGT
TTGGACAACATCTGCTCCATCTATAGTCTCAAGACCCGAGAGGGCAATGTCAGGGTCAGCAGAG
AGCTGCCTGGCCATACTGGGTACCTCTCCTGCTGCCGCTTCCTGGACGACAACCAAATCATCAC
CAGCTCTGGGGACACCACCTGTGCCCTGTGGGACATTGAGACAGGCCAGCAGACAGTGGGATTT
GCTGGACACAGTGGGGATGTGATGTCCCTGTCCCTGGCCCCCGATGGCCGCACCTTTGTGTCAG
GTGCCTGCGATGCCTCCATCAAGCTGTGGGATGTTCGGGATTCCATGTGCCGACAGACATTCAT
AGGTCACGAATCGGACATCAATGCTGTGGCTTTCTTCCCCAATGGTTATGCCTTCACCACGGGA
TCAGATGATGCCACATGTCGCCTGTTTGACCTGCGGGCTGATCAGGAGCTGCTCATGTATTCCC
ACGACAACATCATCTGCGGCATCACCTCGGTTGCCTTCTCACGCAGCGGCCGGCTGCTGCTCGC
TGGCTATGACGACTTCAACTGCAACATCTGGGATGCCATGAAGGGTGACCGTGCAGGTGTCCTC
GCTGGCCATGATAACCGTGTGAGCTGCCTTGGGGTCACAGATGATGGGATGGCTGTGGCTACAG
GCTCCTGGGACTCCTTCCTCAAGATCTGGAACTAACCTCCCCAACCCCAGATGGGCCCAGGCAG
GGAGCAGCCCTGCCCATGCCCACACTACAGGCCCGGAGCTTTGGGGCTGGGCACACATGCCAAG
CCTCCCTCCCTGGGCTACAGGGCCTTGGGTCCTGCTCCCATACCCAGGTTTGGTTCCTCTCGGG
GGGGCCCCCACTGTGGAGATAAAAGTCGGGGATGGAATGGGGGAAGAGGAAGGGCAGGAAAGCC
CTCACCCTTTGCTGCCCTGGGGCCAGGGCCTCACCCCTCTGGAGGGCCAGAGGCAGGAGGTGGA
AACTCCAGGGGCTGGCTTTTTTAACTGGTTTTATTTTAATTTTTATTATATTTTCAGTTTTTCC
ATAAAGGAACCACTTCCAACTCTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

hide sequence

RefSeq Acc Id:

XM_039089799 ⟹ XP_038945727

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	24,796,816 - 24,800,796 (+)	NCBI
mRatBN7.2	12	19,159,965 - 19,164,021 (+)	NCBI

RefSeq Acc Id:

XM_039089800 ⟹ XP_038945728

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	24,795,505 - 24,800,796 (+)	NCBI
mRatBN7.2	12	19,159,909 - 19,164,021 (+)	NCBI

RefSeq Acc Id:

XM_039089801 ⟹ XP_038945729

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	24,797,570 - 24,800,796 (+)	NCBI
mRatBN7.2	12	19,160,796 - 19,164,021 (+)	NCBI

RefSeq Acc Id:

XM_063271695 ⟹ XP_063127765

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	24,795,505 - 24,800,796 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_112299	(Get FASTA)	NCBI Sequence Viewer
	XP_038945727	(Get FASTA)	NCBI Sequence Viewer
	XP_038945728	(Get FASTA)	NCBI Sequence Viewer
	XP_038945729	(Get FASTA)	NCBI Sequence Viewer
	XP_063127765	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB82551	(Get FASTA)	NCBI Sequence Viewer
	AAC72248	(Get FASTA)	NCBI Sequence Viewer
	AAF82123	(Get FASTA)	NCBI Sequence Viewer
	AAH65579	(Get FASTA)	NCBI Sequence Viewer
	AAK84217	(Get FASTA)	NCBI Sequence Viewer
	AAZ23824	(Get FASTA)	NCBI Sequence Viewer
	AAZ23825	(Get FASTA)	NCBI Sequence Viewer
	CAG9553619	(Get FASTA)	NCBI Sequence Viewer
	EDM13262	(Get FASTA)	NCBI Sequence Viewer
	EDM13264	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001911
	ENSRNOP00000001911.3
	ENSRNOP00000079960
GenBank Protein	P54313	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112299 ⟸ NM_031037

- UniProtKB:

Q71SU9 (UniProtKB/Swiss-Prot), P54313 (UniProtKB/Swiss-Prot), A6J023 (UniProtKB/TrEMBL), Q45QL6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWG
TDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKT
REGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSL
APDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLR
ADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGV
TDDGMAVATGSWDSFLKIWN

hide sequence

Ensembl Acc Id:

ENSRNOP00000001911 ⟸ ENSRNOT00000001911

RefSeq Acc Id:	XP_038945728 ⟸ XM_039089800
- Peptide Label:	isoform X1
- UniProtKB:	P54313 (UniProtKB/Swiss-Prot), Q71SU9 (UniProtKB/Swiss-Prot), A6J023 (UniProtKB/TrEMBL), Q45QL6 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945727 ⟸ XM_039089799
- Peptide Label:	isoform X1
- UniProtKB:	P54313 (UniProtKB/Swiss-Prot), Q71SU9 (UniProtKB/Swiss-Prot), A6J023 (UniProtKB/TrEMBL), Q45QL6 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945729 ⟸ XM_039089801
- Peptide Label:	isoform X1
- UniProtKB:	P54313 (UniProtKB/Swiss-Prot), Q71SU9 (UniProtKB/Swiss-Prot), A6J023 (UniProtKB/TrEMBL), Q45QL6 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000079986 ⟸ ENSRNOT00000099940

Ensembl Acc Id:

ENSRNOP00000078220 ⟸ ENSRNOT00000100577

Ensembl Acc Id:

ENSRNOP00000079960 ⟸ ENSRNOT00000097367

Ensembl Acc Id:

ENSRNOP00000097429 ⟸ ENSRNOT00000116394

RefSeq Acc Id:	XP_063127765 ⟸ XM_063271695
- Peptide Label:	isoform X1
- UniProtKB:	Q71SU9 (UniProtKB/Swiss-Prot), P54313 (UniProtKB/Swiss-Prot), A6J023 (UniProtKB/TrEMBL), Q45QL6 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P54313-F1-model_v2	AlphaFold	P54313	1-340	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698518

Promoter ID:

EPDNEW_R9043

Type:

initiation region

Name:

Gnb2_1

Description:

G protein subunit beta 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	22,229,129 - 22,229,189	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69319	AgrOrtholog
BioCyc Gene	G2FUF-19705	BioCyc
Ensembl Genes	ENSRNOG00000001409	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000001911	ENTREZGENE
	ENSRNOT00000001911.5	UniProtKB/Swiss-Prot
	ENSRNOT00000097367	ENTREZGENE
Gene3D-CATH	2.130.10.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5598923	IMAGE-MGC_LOAD
InterPro	G-protein_beta_WD-40_rep	UniProtKB/Swiss-Prot
	Gprotein_B	UniProtKB/Swiss-Prot
	Guanine_nucleotide-bd_bsu	UniProtKB/Swiss-Prot
	WD40/YVTN_repeat-like_dom_sf	UniProtKB/Swiss-Prot
	WD40_repeat	UniProtKB/Swiss-Prot
	WD40_repeat_CS	UniProtKB/Swiss-Prot
	WD40_repeat_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:81667	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72266	IMAGE-MGC_LOAD
NCBI Gene	81667	ENTREZGENE
PANTHER	PTHR19850	UniProtKB/Swiss-Prot
Pfam	WD40_Gbeta	UniProtKB/Swiss-Prot
PhenoGen	Gnb2	PhenoGen
PIRSF	GN-bd_beta	UniProtKB/Swiss-Prot
PRINTS	GPROTEINB	UniProtKB/Swiss-Prot
	GPROTEINBRPT	UniProtKB/Swiss-Prot
PROSITE	WD_REPEATS_1	UniProtKB/Swiss-Prot
	WD_REPEATS_2	UniProtKB/Swiss-Prot
	WD_REPEATS_REGION	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001409	RatGTEx
SMART	WD40	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50978	UniProtKB/Swiss-Prot
UniProt	A0A8I5Y9Z8_RAT	UniProtKB/TrEMBL
	A0A8I5ZP07_RAT	UniProtKB/TrEMBL
	A0A8I6B5S0_RAT	UniProtKB/TrEMBL
	A6J023	ENTREZGENE, UniProtKB/TrEMBL
	GBB2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q45QL6	ENTREZGENE, UniProtKB/TrEMBL
	Q71SU9	ENTREZGENE
UniProt Secondary	Q71SU9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-15	Gnb2	G protein subunit beta 2	Gnb2	guanine nucleotide binding protein (G protein), beta polypeptide 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-26	Gnb2	guanine nucleotide binding protein (G protein), beta polypeptide 2	Gnb2	guanine nucleotide binding protein (G protein), beta 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-05-20	Gnb2	guanine nucleotide binding protein (G protein), beta 2	Gnb2	guanine nucleotide binding protein, beta 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-18	Gnb2	guanine nucleotide binding protein, beta 2	Gnb2	guanine nucleotide binding protein, beta polypeptide 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Gnb2	guanine nucleotide binding protein, beta polypeptide 2			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)