Rbm45 (RNA binding motif protein 45)

Gene: Rbm45 (RNA binding motif protein 45) Rattus norvegicus

Analyze

Symbol:

Rbm45

Name:

RNA binding motif protein 45

RGD ID:

628862

Description:

Predicted to enable RNA binding activity and identical protein binding activity. Involved in nervous system development. Predicted to be located in cytoplasm and nucleoplasm. Predicted to be part of ribonucleoprotein complex. Orthologous to human RBM45 (RNA binding motif protein 45); INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

developmentally regulated RNA-binding protein 1; developmentally-regulated RNA-binding protein 1; Drb1; RNA-binding motif protein 45; RNA-binding protein 45

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RBM45 (RNA binding motif protein 45)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Rbm45 (RNA binding motif protein 45)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RBM45 (RNA binding motif protein 45)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RBM45 (RNA binding motif protein 45)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rbm45 (RNA binding motif protein 45)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RBM45 (RNA binding motif protein 45)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RBM45 (RNA binding motif protein 45)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	JARID2 (jumonji and AT-rich interaction domain containing 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RBM45 (RNA binding motif protein 45)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rbm45 (RNA binding motif protein 45)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rbm45 (RNA binding motif protein 45)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1316	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rbm45	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	81,713,214 - 81,728,190 (+)	NCBI		GRCr8
mRatBN7.2	3	61,305,973 - 61,320,950 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	61,305,924 - 61,320,952 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	64,666,310 - 64,681,282 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	73,249,964 - 73,264,936 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	71,017,083 - 71,032,005 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	63,220,660 - 63,235,638 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	63,220,647 - 63,235,648 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	69,794,037 - 69,809,015 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	59,058,686 - 59,073,662 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	58,955,057 - 58,970,034 (+)	NCBI
Celera	3	60,793,954 - 60,808,930 (+)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-palmitoylglycerol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

avobenzone (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

chlordecone (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

dexamethasone (ISO)

fenthion (ISO)

finasteride (EXP)

flutamide (EXP)

gentamycin (EXP)

indometacin (ISO)

methidathion (ISO)

methylmercury chloride (ISO)

niclosamide (ISO)

ozone (ISO)

paracetamol (ISO)

potassium chromate (ISO)

quercetin (ISO)

sulindac (EXP)

testosterone (ISO)

tetrachloromethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IEA)

nervous system development (IEP)

Cellular Component

cytoplasm (IEA,ISO,ISS)

nucleoplasm (IEA,ISO)

nucleus (ISO,ISS)

ribonucleoprotein complex (IBA)

Molecular Function

identical protein binding (ISO)

protein binding (ISO)

RNA binding (IBA,IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	cDNA cloning and characterization of Drb1, a new member of RRM-type neural RNA-binding protein.	Tamada H, etal., Biochem Biophys Res Commun 2002 Sep 13;297(1):96-104.

Additional References at PubMed

PMID:22658674	PMID:22681889

Genomics

Comparative Map Data

Rbm45
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	81,713,214 - 81,728,190 (+)	NCBI		GRCr8
mRatBN7.2	3	61,305,973 - 61,320,950 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	61,305,924 - 61,320,952 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	64,666,310 - 64,681,282 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	73,249,964 - 73,264,936 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	71,017,083 - 71,032,005 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	63,220,660 - 63,235,638 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	63,220,647 - 63,235,648 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	69,794,037 - 69,809,015 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	59,058,686 - 59,073,662 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	58,955,057 - 58,970,034 (+)	NCBI
Celera	3	60,793,954 - 60,808,930 (+)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

RBM45
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	178,112,437 - 178,139,011 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	178,112,424 - 178,139,011 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	178,977,164 - 178,994,383 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	178,685,428 - 178,702,629 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	178,802,657 - 178,819,887	NCBI
Celera	2	172,580,082 - 172,597,283 (+)	NCBI		Celera
Cytogenetic Map	2	q31.2	NCBI
HuRef	2	170,847,670 - 170,864,858 (+)	NCBI		HuRef
CHM1_1	2	178,983,291 - 179,000,485 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	178,595,169 - 178,612,405 (+)	NCBI		T2T-CHM13v2.0

Rbm45
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	76,200,304 - 76,214,112 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	76,200,328 - 76,214,112 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	76,369,959 - 76,383,768 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	76,369,984 - 76,383,768 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	76,208,041 - 76,221,825 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	76,170,907 - 76,184,555 (+)	NCBI		MGSCv36	mm8
Celera	2	78,035,769 - 78,049,840 (+)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	44.94	NCBI

RBM45
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	80,760,404 - 80,775,297 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	80,775,370 - 80,790,271 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	65,372,463 - 65,386,211 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	183,078,303 - 183,095,479 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	183,078,303 - 183,095,479 (+)	Ensembl	panpan1.1		panPan2

RBM45
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	21,749,351 - 21,767,742 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	21,749,346 - 21,767,938 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	21,768,482 - 21,790,783 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	21,893,038 - 21,915,335 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	21,893,032 - 21,910,497 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	22,002,284 - 22,024,604 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	21,965,690 - 21,988,186 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	22,080,957 - 22,099,946 (+)	NCBI		UU_Cfam_GSD_1.0

Rbm45
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	138,805,596 - 138,835,304 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	7,359,468 - 7,377,458 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936509	7,359,511 - 7,376,994 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RBM45
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	83,792,861 - 83,824,556 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	83,792,849 - 83,810,337 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	93,330,076 - 93,352,111 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RBM45
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	63,656,295 - 63,674,773 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	63,656,337 - 63,675,540 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	135,888,154 - 135,912,977 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Rbm45
98 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	50
Count of miRNA genes:	36
Interacting mature miRNAs:	44
Transcripts:	ENSRNOT00000042968
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	62951183	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1582249	Bw77	Body weight QTL 77	3.2	0.0025	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	64655484	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	53781112	91609953	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	3	53781112	91609953	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	61134348	89115068	Rat

Markers in Region

RH131062

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	61,320,611 - 61,320,797 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	63,235,300 - 63,235,485	NCBI	Rnor6.0
Rnor_5.0	3	69,808,677 - 69,808,862	UniSTS	Rnor5.0
RGSC_v3.4	3	59,073,324 - 59,073,509	UniSTS	RGSC3.4
Celera	3	60,808,592 - 60,808,777	UniSTS
Cytogenetic Map	3	q23	UniSTS

RH136880

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	61,309,447 - 61,309,667 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	63,224,135 - 63,224,354	NCBI	Rnor6.0
Rnor_5.0	3	69,797,512 - 69,797,731	UniSTS	Rnor5.0
RGSC_v3.4	3	59,062,161 - 59,062,380	UniSTS	RGSC3.4
Celera	3	60,797,429 - 60,797,648	UniSTS
Cytogenetic Map	3	q23	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	28	53	37	19	37	1	1	74	35	41	11	1
Low		15	4	4		4	7	10					7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_153306	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB036990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000042968 ⟹ ENSRNOP00000051270

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	61,305,924 - 61,320,952 (+)	Ensembl
Rnor_6.0 Ensembl	3	63,220,647 - 63,235,648 (+)	Ensembl

RefSeq Acc Id:

NM_153306 ⟹ NP_695218

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	81,713,214 - 81,728,190 (+)	NCBI
mRatBN7.2	3	61,305,973 - 61,320,950 (+)	NCBI
Rnor_6.0	3	63,220,660 - 63,235,638 (+)	NCBI
Rnor_5.0	3	69,794,037 - 69,809,015 (+)	NCBI
RGSC_v3.4	3	59,058,686 - 59,073,662 (+)	RGD
Celera	3	60,793,954 - 60,808,930 (+)	RGD

Sequence:

show sequence

GGGTGGACAGAGCCTGCGGGGGGCTGCGCCTGGCTCCCGCGCGGGGCACCATGGACGACGCCGG
CAGCTCCGGAGGCAGCGGAGGCTTCCGCCCCGGAGTAGACAGTCTGGATGAGCCGCCCAACAGC
CGCATCTTCCTAGTGATCAGCAAGTACACATCGGAATCGGTGCTGAGGGAGCACTTCTCGCCCT
TCGGAGACATCCAGGACATCTGGGTAGTGCGCGACAAGCACACTAAGGAGTCCAAGGGCATCGC
CTTCGTCAAGTTCGCACGCAGCTCACAGGCCTGCCGGGCTATGGAGGAGATGCACGGACAGTGC
CTTGGTCCCAACGACACCAAGCCCATCAAGGTTTTCATTGCCCAGTCCCGATCATCAGGGAGTC
ACAGGGATGTCGAAGACGAAGAGCTCACGAGGATCTTTGTCATGATACCAAAGTCCTACACGGA
GGAAGACCTGCGGGAGAAGTTCAAGGTGTATGGAGACATCGAGTACTGCAGCGTTATTAAGAAT
AAAGTCACTGGAGAAAGTAAAGGCTTGGGCTACGTGCGGTACTTAAAACCATCACAAGCTGCCC
AGGCAATAGAAAACTGTGATAGAAGTTTCAGAGCACTCTTGGCTGAACCTAAAAATAAAGTGTT
GGAGTCCCCAGAACAAGATTATTACAGTAGCGTGAGGCAGGAGACTTTGGGGCACGAGCCTAGA
GGAAATCTGTTTCCCTTCGTTGGAGAACAACAATCTGAATTTTCAACTTTTGACAAGAACGATA
GCAGAGGCCAGGAAGCTATCTCCAAACGCCTGTCGGTGGCGTCGAGGGTCCCCTTCACAGAGGA
GCAGCTCTTCAGCATTTTTGACATCGTCCCAGGGCTGGAGTACTGTGAGGTTCACCGAGACCCT
TACTTAAATTATGGTCATGGCGTGGTTCAGTATTTTAACGTGGCATCGGCTGTTTATGCACAAT
ACAAACTGCATGGATTCCAGTACCCTCCCGGGAATCGGATAGCTGTTTCCTTTCTGGATGACGG
AAGTAATTCAGCTGATCTCATCAGGAAAATGGCCACACAGATGGTGGCGGCACAGCTCGCGTCA
ACGGTGTGGAGTAACCCGAGTCACCAGCAGTTTCTGCAATTCGGAGGAAGTGCTGGGTCACAAG
TGCCTCAAATCCAGACAGACGTAGTACTTCCGTCATGCAGAAAGAAAGCCCCACCGGAAACTCC
TGTGAAAGAAAGGCTGTTTATTGTGTTTAATCCCCATCCTTTGCCGTTAGACGTGTTGGAGGAT
ATATTCTGCCGTTTTGGGAACCTGATTGAGGTCTACCTTGTGTCGGGGAAAAATGTGGGCTATG
TCAAGTATGCTGATAGAATGAGCGCCAATGACGCCATCACAACTCTGCACGGGAAGATTCTAAA
TGGGGTCAGACTTAAGGTTATGCTGGCAGATTCCCCAAGAGAAGTATCCAAAAAGAGGCAGAGA
ACTTACTGAGTTTTAAGGACAAAGACTAACTAATGACATAATCCTCAGCTGACTGACTGAAAAC
CTGACTGGACGAACCCCTGTGGACAGTTGACAGCTTTTTTTTTCTTTTCCTCACATATTTGATA
GTTTACACACCATTGCCTATCTGGGATCGCTGACATGTATTTTTATCTGACCTTAATGGTAAAA
TTAATATAGTAGTTGTTTCCTAGAACAAAATGTTGCTGTGTATAGCAGAAATAAAGCTTCCTTA
GAGAAATATGTTGTCATGTATAGCAGAAATAAAGTTTGCTTTGTATAACT

hide sequence

Protein Sequences


Protein RefSeqs	NP_695218	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAC16206	(Get FASTA)	NCBI Sequence Viewer
	EDL79224	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000051270
	ENSRNOP00000051270.1
GenBank Protein	Q8CFD1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_695218 ⟸ NM_153306

- UniProtKB:

Q8CFD1 (UniProtKB/Swiss-Prot), A6HMH3 (UniProtKB/TrEMBL), G3V9K8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDDAGSSGGSGGFRPGVDSLDEPPNSRIFLVISKYTSESVLREHFSPFGDIQDIWVVRDKHTKE
SKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEELTRIFVMIP
KSYTEEDLREKFKVYGDIEYCSVIKNKVTGESKGLGYVRYLKPSQAAQAIENCDRSFRALLAEP
KNKVLESPEQDYYSSVRQETLGHEPRGNLFPFVGEQQSEFSTFDKNDSRGQEAISKRLSVASRV
PFTEEQLFSIFDIVPGLEYCEVHRDPYLNYGHGVVQYFNVASAVYAQYKLHGFQYPPGNRIAVS
FLDDGSNSADLIRKMATQMVAAQLASTVWSNPSHQQFLQFGGSAGSQVPQIQTDVVLPSCRKKA
PPETPVKERLFIVFNPHPLPLDVLEDIFCRFGNLIEVYLVSGKNVGYVKYADRMSANDAITTLH
GKILNGVRLKVMLADSPREVSKKRQRTY

hide sequence

RefSeq Acc Id:

ENSRNOP00000051270 ⟸ ENSRNOT00000042968

Protein Domains

RRM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8CFD1-F1-model_v2	AlphaFold	Q8CFD1	1-476	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692158

Promoter ID:

EPDNEW_R2683

Type:

multiple initiation site

Name:

Rbm45_1

Description:

RNA binding motif protein 45

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	63,220,611 - 63,220,671	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628862	AgrOrtholog
BioCyc Gene	G2FUF-49281	BioCyc
Ensembl Genes	ENSRNOG00000010595	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000042968	ENTREZGENE
	ENSRNOT00000042968.3	UniProtKB/TrEMBL
Gene3D-CATH	3.30.70.330	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Nucleotide-bd_a/b_plait_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RBD_domain_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RBM45_RRM1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RBM45_RRM2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RBM45_RRM3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RBM45_RRM4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RRM_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:266631	UniProtKB/Swiss-Prot
NCBI Gene	266631	ENTREZGENE
PANTHER	EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT G	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RNA-BINDING MOTIF PROTEIN 45	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	RRM_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rbm45	PhenoGen
PROSITE	RRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000010595	RatGTEx
SMART	RRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54928	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6HMH3	ENTREZGENE, UniProtKB/TrEMBL
	G3V9K8	ENTREZGENE, UniProtKB/TrEMBL
	Q8CFD1	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-25	Rbm45	RNA binding motif protein 45	Drb1	developmentally regulated RNA-binding protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Drb1	developmentally regulated RNA-binding protein 1			Symbol and Name status set to approved	1299863	APPROVED
2003-02-27	Drb1	developmentally regulated RNA-binding protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localizes to the cytoplasm	625598
gene_domains	contains four RNA recognition motif (RRM)-type RNA-binding domains (RBDs)	625598
gene_expression	specifically expressed in fetal (E12, E16) brain and gradually reduced during development	632617
gene_expression	expressed in neurons (but not in glial cells) of fetal brain and reduced during development	625598
gene_homology	amino acid sequence is 91.8% and 91.6% identical to mouse and human respectively	625598
gene_process	regulates mRNA expression of c-fos and FGFR-1 and decreases the mRNA level of cytochrome P450 aromatase	625598
gene_process	plays a role in cellular growth, differentiation, angiogenesis, tissue repair and cell migration	625598
gene_process	mediates Leydig cell steroidogenesis, Sertoli cell transferrin production and plasminogen activator activity in testis	625598
gene_product	belongs to RRM-type RNA-binding protein family	632617
gene_protein	476 amino acids; 53kDa	632617
gene_protein	476 amino acids, 53 kDa	625598

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar