Symbol:
Il13ra1
Name:
interleukin 13 receptor subunit alpha 1
RGD ID:
628741
Description:
Enables interleukin-13 receptor activity. Involved in positive regulation of B cell proliferation and positive regulation of immunoglobulin production. Human ortholog(s) of this gene implicated in asthma and chronic obstructive pulmonary disease. Orthologous to human IL13RA1 (interleukin 13 receptor subunit alpha 1); PARTICIPATES IN interleukin-4 signaling pathway; cytokine mediated signaling pathway; Jak-Stat signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2-amino-2-deoxy-D-glucopyranose.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
interleukin 13 receptor, alpha 1; interleukin-13 receptor subunit alpha-1; MGC105309
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Il13ra1-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 120,213,670 - 120,294,777 (+) NCBI GRCr8 mRatBN7.2 X 115,348,822 - 115,408,682 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 71,254,928 - 71,258,678 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl X 115,348,860 - 115,408,681 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 117,450,135 - 117,510,865 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 121,019,209 - 121,079,947 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 118,565,417 - 118,626,152 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 122,724,081 - 122,783,801 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 122,724,129 - 122,781,479 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 122,873,725 - 122,933,124 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 8,758,662 - 8,820,545 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 8,764,214 - 8,826,101 (-) NCBI Celera X 114,585,012 - 114,644,379 (+) NCBI Celera Cytogenetic Map X q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Il13ra1 Rat 1,2-dimethylhydrazine decreases expression ISO Il13ra1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of IL13RA1 mRNA CTD PMID:22206623 Il13ra1 Rat 17beta-estradiol multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 [Estradiol co-treated with Norethindrone Acetate] results in increased expression of IL13RA1 mRNA CTD PMID:22217510 Il13ra1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO IL13RA1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of IL13RA1 mRNA CTD PMID:17101203 Il13ra1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of IL13RA1 mRNA CTD PMID:34747641 Il13ra1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Il13ra1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of IL13RA1 mRNA CTD PMID:21570461 Il13ra1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Il13ra1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of IL13RA1 mRNA CTD PMID:15652763 more ... Il13ra1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of IL13RA1 mRNA CTD PMID:21346803 Il13ra1 Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in increased expression of IL13RA1 mRNA] CTD PMID:17109745 Il13ra1 Rat 2-amino-2-deoxy-D-glucopyranose decreases expression EXP 6480464 Glucosamine results in decreased expression of IL13RA1 mRNA CTD PMID:17109745 Il13ra1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of IL13RA1 mRNA CTD PMID:28522335 Il13ra1 Rat 4,4'-sulfonyldiphenol increases expression ISO Il13ra1 (Mus musculus) 6480464 bisphenol S results in increased expression of IL13RA1 mRNA CTD PMID:30951980 Il13ra1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO IL13RA1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of IL13RA1 gene CTD PMID:38338858 Il13ra1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Il13ra1 (Mus musculus) 6480464 bisphenol S results in decreased expression of IL13RA1 mRNA CTD PMID:39298647 Il13ra1 Rat 4-hydroxynon-2-enal decreases expression ISO Il13ra1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of IL13RA1 mRNA CTD PMID:19191707 Il13ra1 Rat 4-hydroxyphenyl retinamide increases expression ISO Il13ra1 (Mus musculus) 6480464 Fenretinide results in increased expression of IL13RA1 mRNA CTD PMID:28973697 Il13ra1 Rat 5-aza-2'-deoxycytidine increases expression ISO IL13RA1 (Homo sapiens) 6480464 Decitabine results in increased expression of IL13RA1 mRNA CTD PMID:20381863 Il13ra1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of IL13RA1 mRNA CTD PMID:24780913 Il13ra1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of IL13RA1 mRNA CTD PMID:31881176 Il13ra1 Rat acrylamide affects expression EXP 6480464 Acrylamide affects the expression of IL13RA1 mRNA CTD PMID:28959563 Il13ra1 Rat aflatoxin B1 increases expression ISO Il13ra1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of IL13RA1 mRNA CTD PMID:19770486 Il13ra1 Rat aflatoxin B1 decreases methylation ISO IL13RA1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of IL13RA1 gene CTD PMID:27153756 Il13ra1 Rat aldehydo-D-glucosamine multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in increased expression of IL13RA1 mRNA] CTD PMID:17109745 Il13ra1 Rat aldehydo-D-glucosamine decreases expression EXP 6480464 Glucosamine results in decreased expression of IL13RA1 mRNA CTD PMID:17109745 Il13ra1 Rat all-trans-retinoic acid increases expression ISO IL13RA1 (Homo sapiens) 6480464 Tretinoin results in increased expression of IL13RA1 mRNA CTD PMID:21934132 more ... Il13ra1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of IL13RA1 mRNA CTD PMID:16483693 Il13ra1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of IL13RA1 mRNA CTD PMID:30779732 Il13ra1 Rat benzene multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of IL13RA1 mRNA CTD PMID:17905399 Il13ra1 Rat benzo[a]pyrene decreases expression ISO Il13ra1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of IL13RA1 mRNA CTD PMID:19770486 Il13ra1 Rat benzo[a]pyrene decreases methylation ISO IL13RA1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of IL13RA1 3' UTR CTD PMID:27901495 Il13ra1 Rat benzo[a]pyrene affects methylation ISO IL13RA1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of IL13RA1 exon and Benzo(a)pyrene affects the methylation of IL13RA1 promoter CTD PMID:27901495 Il13ra1 Rat beta-D-glucosamine multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in increased expression of IL13RA1 mRNA] CTD PMID:17109745 Il13ra1 Rat beta-D-glucosamine decreases expression EXP 6480464 Glucosamine results in decreased expression of IL13RA1 mRNA CTD PMID:17109745 Il13ra1 Rat beta-lapachone increases expression ISO IL13RA1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of IL13RA1 mRNA CTD PMID:38218311 Il13ra1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Il13ra1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of IL13RA1 mRNA CTD PMID:35550907 Il13ra1 Rat bisphenol A decreases expression ISO IL13RA1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of IL13RA1 mRNA CTD PMID:22576693 Il13ra1 Rat bisphenol A decreases methylation ISO IL13RA1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of IL13RA1 gene CTD PMID:38338858 Il13ra1 Rat bisphenol A multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of IL13RA1 gene CTD PMID:31601247 Il13ra1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of IL13RA1 mRNA CTD PMID:34947998 Il13ra1 Rat bisphenol A increases expression ISO Il13ra1 (Mus musculus) 6480464 bisphenol A results in increased expression of IL13RA1 mRNA CTD PMID:30951980 and PMID:32156529 Il13ra1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of IL13RA1 mRNA CTD PMID:30816183 Il13ra1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of IL13RA1 mRNA CTD PMID:25181051 Il13ra1 Rat bisphenol A increases methylation ISO IL13RA1 (Homo sapiens) 6480464 bisphenol A results in increased methylation of IL13RA1 gene CTD PMID:22576693 Il13ra1 Rat bisphenol F increases expression ISO Il13ra1 (Mus musculus) 6480464 bisphenol F results in increased expression of IL13RA1 mRNA CTD PMID:30951980 Il13ra1 Rat bisphenol F decreases methylation ISO IL13RA1 (Homo sapiens) 6480464 bisphenol F results in decreased methylation of IL13RA1 gene CTD PMID:38338858 Il13ra1 Rat bleomycin A2 multiple interactions ISO Il13ra1 (Mus musculus) 6480464 Cannabidiol analog inhibits the reaction [Bleomycin results in increased expression of IL13RA1 mRNA] and lenabasum inhibits the reaction [Bleomycin results in increased expression of IL13RA1 mRNA] CTD PMID:30825431 Il13ra1 Rat bleomycin A2 increases expression ISO Il13ra1 (Mus musculus) 6480464 Bleomycin results in increased expression of IL13RA1 mRNA CTD PMID:30825431 and PMID:36087614 Il13ra1 Rat Brevianamide A increases expression ISO Il13ra1 (Mus musculus) 6480464 brevianamide A results in increased expression of IL13RA1 mRNA CTD PMID:19818335 Il13ra1 Rat butanal decreases expression ISO IL13RA1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of IL13RA1 mRNA CTD PMID:26079696 Il13ra1 Rat cadmium atom decreases expression ISO IL13RA1 (Homo sapiens) 6480464 Cadmium results in decreased expression of IL13RA1 mRNA CTD PMID:23369406 Il13ra1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of IL13RA1 mRNA CTD PMID:25993096 Il13ra1 Rat cadmium dichloride increases expression ISO IL13RA1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of IL13RA1 mRNA CTD PMID:38382870 Il13ra1 Rat Calcimycin multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Calcimycin] results in increased expression of IL13RA1 mRNA and fulvic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Calcimycin] results in increased expression of IL13RA1 mRNA] CTD PMID:21331654 Il13ra1 Rat cannabidiol decreases expression ISO IL13RA1 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of IL13RA1 mRNA CTD PMID:27932991 Il13ra1 Rat cannabidiol multiple interactions ISO Il13ra1 (Mus musculus) 6480464 Cannabidiol analog inhibits the reaction [Bleomycin results in increased expression of IL13RA1 mRNA] CTD PMID:30825431 Il13ra1 Rat carbamazepine affects expression ISO IL13RA1 (Homo sapiens) 6480464 Carbamazepine affects the expression of IL13RA1 mRNA CTD PMID:25979313 Il13ra1 Rat carbon nanotube increases expression ISO Il13ra1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Il13ra1 Rat CGP 52608 multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to IL13RA1 gene] CTD PMID:28238834 Il13ra1 Rat choline multiple interactions ISO Il13ra1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of IL13RA1 gene CTD PMID:20938992 Il13ra1 Rat chromium(6+) affects expression ISO Il13ra1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of IL13RA1 mRNA CTD PMID:28472532 Il13ra1 Rat cisplatin decreases response to substance ISO IL13RA1 (Homo sapiens) 6480464 IL13RA1 protein results in decreased susceptibility to Cisplatin CTD PMID:16734730 Il13ra1 Rat cisplatin increases expression ISO IL13RA1 (Homo sapiens) 6480464 Cisplatin results in increased expression of IL13RA1 mRNA CTD PMID:27594783 Il13ra1 Rat copper(II) sulfate decreases expression ISO IL13RA1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of IL13RA1 mRNA CTD PMID:19549813 Il13ra1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of IL13RA1 mRNA CTD PMID:27523638 Il13ra1 Rat cyclophosphamide increases expression ISO Il13ra1 (Mus musculus) 6480464 Cyclophosphamide results in increased expression of IL13RA1 mRNA CTD PMID:21041162 Il13ra1 Rat cyclosporin A decreases expression ISO IL13RA1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of IL13RA1 mRNA CTD PMID:20106945 Il13ra1 Rat dexamethasone increases expression ISO Il13ra1 (Mus musculus) 6480464 Dexamethasone results in increased expression of IL13RA1 mRNA CTD PMID:21041162 Il13ra1 Rat Dibutyl phosphate affects expression ISO IL13RA1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of IL13RA1 mRNA CTD PMID:37042841 Il13ra1 Rat dibutyl phthalate increases expression ISO Il13ra1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of IL13RA1 mRNA CTD PMID:21266533 Il13ra1 Rat diclofenac increases expression ISO Il13ra1 (Mus musculus) 6480464 Diclofenac results in increased expression of IL13RA1 mRNA CTD PMID:26934552 Il13ra1 Rat dioxygen increases expression ISO Il13ra1 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of IL13RA1 mRNA CTD PMID:20880076 Il13ra1 Rat dioxygen multiple interactions ISO Il13ra1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of IL13RA1 mRNA and HIF1A protein promotes the reaction [Oxygen deficiency results in increased expression of IL13RA1 mRNA] CTD PMID:20880076 and PMID:30529165 Il13ra1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of IL13RA1 mRNA CTD PMID:21551480 Il13ra1 Rat dorsomorphin multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Il13ra1 Rat doxorubicin decreases expression ISO IL13RA1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of IL13RA1 mRNA CTD PMID:29803840 Il13ra1 Rat ethyl methanesulfonate increases expression ISO IL13RA1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of IL13RA1 mRNA CTD PMID:23649840 Il13ra1 Rat fenthion decreases expression ISO Il13ra1 (Mus musculus) 6480464 Fenthion results in decreased expression of IL13RA1 mRNA CTD PMID:34813904 Il13ra1 Rat ferulic acid multiple interactions ISO Il13ra1 (Mus musculus) 6480464 ferulic acid inhibits the reaction [Imiquimod results in increased expression of IL13RA1 mRNA] CTD PMID:31054998 Il13ra1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of IL13RA1 mRNA CTD PMID:23962444 Il13ra1 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of IL13RA1 mRNA CTD PMID:34044035 Il13ra1 Rat fluoranthene multiple interactions ISO Il13ra1 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of IL13RA1 mRNA CTD PMID:28329830 Il13ra1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of IL13RA1 mRNA CTD PMID:24136188 Il13ra1 Rat folic acid multiple interactions ISO Il13ra1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of IL13RA1 gene CTD PMID:20938992 Il13ra1 Rat formaldehyde increases expression ISO IL13RA1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of IL13RA1 mRNA CTD PMID:23649840 Il13ra1 Rat fulvestrant multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of IL13RA1 gene CTD PMID:31601247 Il13ra1 Rat Fulvic acid multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 fulvic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Calcimycin] results in increased expression of IL13RA1 mRNA] CTD PMID:21331654 Il13ra1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of IL13RA1 gene CTD PMID:22079235 Il13ra1 Rat heptachlor decreases expression EXP 6480464 Heptachlor results in decreased expression of IL13RA1 mRNA CTD PMID:23153324 Il13ra1 Rat imiquimod multiple interactions ISO Il13ra1 (Mus musculus) 6480464 ferulic acid inhibits the reaction [Imiquimod results in increased expression of IL13RA1 mRNA] CTD PMID:31054998 Il13ra1 Rat imiquimod increases expression ISO Il13ra1 (Mus musculus) 6480464 Imiquimod results in increased expression of IL13RA1 mRNA CTD PMID:31054998 Il13ra1 Rat irinotecan affects expression EXP 6480464 Irinotecan affects the expression of IL13RA1 mRNA CTD PMID:20097248 Il13ra1 Rat isotretinoin decreases expression ISO IL13RA1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of IL13RA1 mRNA CTD PMID:20436886 Il13ra1 Rat L-methionine multiple interactions ISO Il13ra1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of IL13RA1 gene CTD PMID:20938992 Il13ra1 Rat lipopolysaccharide multiple interactions ISO Il13ra1 (Mus musculus) 6480464 (+)-JQ1 compound inhibits the reaction [Lipopolysaccharides results in increased expression of IL13RA1 mRNA] CTD PMID:26582142 Il13ra1 Rat lipopolysaccharide increases expression ISO Il13ra1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of IL13RA1 mRNA CTD PMID:26582142 Il13ra1 Rat mercury dibromide increases expression ISO IL13RA1 (Homo sapiens) 6480464 mercuric bromide results in increased expression of IL13RA1 mRNA CTD PMID:26272509 Il13ra1 Rat mercury dibromide multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IL13RA1 mRNA CTD PMID:27188386 Il13ra1 Rat methotrexate increases expression ISO IL13RA1 (Homo sapiens) 6480464 Methotrexate results in increased expression of IL13RA1 mRNA CTD PMID:21678067 Il13ra1 Rat methyl methanesulfonate increases expression ISO IL13RA1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of IL13RA1 mRNA CTD PMID:23649840 Il13ra1 Rat methylmercury(1+) multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of IL13RA1 mRNA CTD PMID:17905399 Il13ra1 Rat microcystin-LR increases expression ISO Il13ra1 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of IL13RA1 mRNA CTD PMID:37342990 Il13ra1 Rat mycotoxin increases expression ISO Il13ra1 (Mus musculus) 6480464 Mycotoxins results in increased expression of IL13RA1 mRNA CTD PMID:19818335 Il13ra1 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine increases expression ISO IL13RA1 (Homo sapiens) 6480464 N more ... CTD PMID:19013360 Il13ra1 Rat N-methyl-4-phenylpyridinium increases expression ISO IL13RA1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of IL13RA1 mRNA CTD PMID:24810058 Il13ra1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of IL13RA1 mRNA CTD PMID:24136188 Il13ra1 Rat nickel atom increases expression ISO IL13RA1 (Homo sapiens) 6480464 Nickel results in increased expression of IL13RA1 mRNA CTD PMID:25583101 Il13ra1 Rat nickel sulfate increases expression ISO IL13RA1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of IL13RA1 mRNA CTD PMID:22714537 Il13ra1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of IL13RA1 mRNA CTD PMID:25729387 Il13ra1 Rat ozone multiple interactions ISO Il13ra1 (Mus musculus) 6480464 [Soot co-treated with Ozone] results in increased expression of IL13RA1 mRNA CTD PMID:36303316 Il13ra1 Rat ozone multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of IL13RA1 mRNA CTD PMID:35430440 Il13ra1 Rat paracetamol affects expression ISO Il13ra1 (Mus musculus) 6480464 Acetaminophen affects the expression of IL13RA1 mRNA CTD PMID:17562736 Il13ra1 Rat paracetamol decreases expression ISO IL13RA1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of IL13RA1 mRNA CTD PMID:31059760 Il13ra1 Rat phenobarbital multiple interactions ISO Il13ra1 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of IL13RA1 mRNA] CTD PMID:19482888 Il13ra1 Rat phenobarbital affects expression ISO Il13ra1 (Mus musculus) 6480464 Phenobarbital affects the expression of IL13RA1 mRNA CTD PMID:23091169 Il13ra1 Rat phenobarbital decreases expression ISO Il13ra1 (Mus musculus) 6480464 Phenobarbital results in decreased expression of IL13RA1 mRNA CTD PMID:19482888 Il13ra1 Rat phenylmercury acetate increases expression ISO IL13RA1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of IL13RA1 mRNA CTD PMID:26272509 Il13ra1 Rat phenylmercury acetate multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IL13RA1 mRNA CTD PMID:27188386 Il13ra1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Calcimycin] results in increased expression of IL13RA1 mRNA and fulvic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Calcimycin] results in increased expression of IL13RA1 mRNA] CTD PMID:21331654 Il13ra1 Rat pirinixic acid decreases expression ISO Il13ra1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of IL13RA1 mRNA CTD PMID:23811191 Il13ra1 Rat potassium chromate decreases expression ISO IL13RA1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of IL13RA1 mRNA CTD PMID:22714537 Il13ra1 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Il13ra1 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of IL13RA1 mRNA CTD PMID:27413110 and PMID:28903501 Il13ra1 Rat progesterone decreases expression ISO IL13RA1 (Homo sapiens) 6480464 Progesterone results in decreased expression of IL13RA1 mRNA CTD PMID:21795739 Il13ra1 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of IL13RA1 mRNA CTD PMID:21770760 Il13ra1 Rat protein kinase inhibitor multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in decreased expression of IL13RA1 mRNA] CTD PMID:28003376 Il13ra1 Rat raloxifene increases expression ISO IL13RA1 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of IL13RA1 mRNA CTD PMID:22217510 Il13ra1 Rat SB 431542 multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Il13ra1 Rat senecionine decreases expression ISO Il13ra1 (Mus musculus) 6480464 senecionine results in decreased expression of IL13RA1 protein CTD PMID:35357534 Il13ra1 Rat silicon dioxide decreases expression ISO Il13ra1 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of IL13RA1 mRNA CTD PMID:19073995 Il13ra1 Rat sodium arsenate increases expression ISO Il13ra1 (Mus musculus) 6480464 sodium arsenate results in increased expression of IL13RA1 mRNA CTD PMID:21795629 Il13ra1 Rat sodium arsenite increases expression ISO IL13RA1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of IL13RA1 mRNA CTD PMID:22714537 Il13ra1 Rat sodium arsenite decreases expression ISO Il13ra1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of IL13RA1 mRNA CTD PMID:33933676 Il13ra1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of IL13RA1 mRNA CTD PMID:25993096 Il13ra1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of IL13RA1 mRNA CTD PMID:19281266 Il13ra1 Rat succimer multiple interactions ISO Il13ra1 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of IL13RA1 mRNA CTD PMID:21641980 Il13ra1 Rat sulindac sulfide decreases expression ISO IL13RA1 (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of IL13RA1 mRNA CTD PMID:16184548 Il13ra1 Rat sunitinib decreases expression ISO IL13RA1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of IL13RA1 mRNA CTD PMID:31533062 Il13ra1 Rat temozolomide decreases expression ISO IL13RA1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of IL13RA1 mRNA CTD PMID:31758290 Il13ra1 Rat tetrachloromethane affects expression ISO Il13ra1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of IL13RA1 mRNA CTD PMID:17484886 Il13ra1 Rat tetrachloromethane increases expression ISO Il13ra1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of IL13RA1 mRNA CTD PMID:18263696 Il13ra1 Rat thimerosal decreases expression ISO IL13RA1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of IL13RA1 mRNA CTD PMID:27188386 Il13ra1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of IL13RA1 mRNA CTD PMID:34492290 Il13ra1 Rat tibolone increases expression ISO IL13RA1 (Homo sapiens) 6480464 tibolone results in increased expression of IL13RA1 mRNA CTD PMID:22217510 Il13ra1 Rat titanium dioxide affects expression ISO Il13ra1 (Mus musculus) 6480464 titanium dioxide affects the expression of IL13RA1 mRNA CTD PMID:23557971 Il13ra1 Rat titanium dioxide decreases methylation ISO Il13ra1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of IL13RA1 gene CTD PMID:35295148 Il13ra1 Rat TMC-120A increases expression ISO Il13ra1 (Mus musculus) 6480464 TMC 120A results in increased expression of IL13RA1 mRNA CTD PMID:19818335 Il13ra1 Rat toluene increases expression EXP 6480464 Toluene results in increased expression of IL13RA1 mRNA CTD PMID:22967744 Il13ra1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of IL13RA1 mRNA CTD PMID:25729387 Il13ra1 Rat torcetrapib increases expression ISO IL13RA1 (Homo sapiens) 6480464 torcetrapib results in increased expression of IL13RA1 mRNA CTD PMID:23228038 Il13ra1 Rat trichloroethene multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of IL13RA1 mRNA CTD PMID:17905399 Il13ra1 Rat trichostatin A increases expression ISO IL13RA1 (Homo sapiens) 6480464 trichostatin A results in increased expression of IL13RA1 mRNA CTD PMID:24935251 and PMID:26272509 Il13ra1 Rat trichostatin A multiple interactions ISO IL13RA1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IL13RA1 mRNA CTD PMID:27188386 Il13ra1 Rat triphenyl phosphate affects expression ISO IL13RA1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of IL13RA1 mRNA CTD PMID:37042841 Il13ra1 Rat urethane decreases expression ISO IL13RA1 (Homo sapiens) 6480464 Urethane results in decreased expression of IL13RA1 mRNA CTD PMID:28818685 Il13ra1 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of IL13RA1 mRNA CTD PMID:24136188 Il13ra1 Rat valproic acid decreases methylation ISO IL13RA1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of IL13RA1 gene CTD PMID:29154799 Il13ra1 Rat valproic acid increases expression ISO IL13RA1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of IL13RA1 mRNA CTD PMID:28001369 Il13ra1 Rat valproic acid affects expression ISO IL13RA1 (Homo sapiens) 6480464 Valproic Acid affects the expression of IL13RA1 mRNA CTD PMID:25979313 Il13ra1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of IL13RA1 mRNA CTD PMID:19015723 Il13ra1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of IL13RA1 mRNA CTD PMID:23555832 Il13ra1 Rat vitamin E increases expression ISO IL13RA1 (Homo sapiens) 6480464 Vitamin E results in increased expression of IL13RA1 mRNA CTD PMID:19244175
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2-amino-2-deoxy-D-glucopyranose (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) aldehydo-D-glucosamine (EXP) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphetamine (EXP) benzene (EXP) benzo[a]pyrene (ISO) beta-D-glucosamine (EXP) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (ISO) Brevianamide A (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) Calcimycin (ISO) cannabidiol (ISO) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyclophosphamide (ISO) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diclofenac (ISO) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) ethyl methanesulfonate (ISO) fenthion (ISO) ferulic acid (ISO) fipronil (EXP) fluoranthene (ISO) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) fulvestrant (ISO) Fulvic acid (ISO) furan (EXP) heptachlor (EXP) imiquimod (ISO) irinotecan (EXP) isotretinoin (ISO) L-methionine (ISO) lipopolysaccharide (ISO) mercury dibromide (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) methylmercury(1+) (EXP) microcystin-LR (ISO) mycotoxin (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-methyl-4-phenylpyridinium (ISO) nefazodone (EXP) nickel atom (ISO) nickel sulfate (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (EXP,ISO) protein kinase inhibitor (ISO) raloxifene (ISO) SB 431542 (ISO) senecionine (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dichromate (EXP) Soman (EXP) succimer (ISO) sulindac sulfide (ISO) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (ISO) thimerosal (ISO) thioacetamide (EXP) tibolone (ISO) titanium dioxide (ISO) TMC-120A (ISO) toluene (EXP) topotecan (EXP) torcetrapib (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) urethane (ISO) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO)
1.
Novel polymorphism in the coding region of the IL-13 receptor alpha' gene: association study with atopic asthma in the Japanese population.
Ahmed S, etal., Exp Clin Immunogenet. 2000;17(1):18-22.
2.
Polymorphisms in IL13 pathway genes in asthma and chronic obstructive pulmonary disease.
Beghe B, etal., Allergy. 2010 Apr;65(4):474-81. Epub 2009 Oct 1.
3.
IL-13 fusion cytotoxin ameliorates chronic fungal-induced allergic airway disease in mice.
Blease K, etal., J Immunol. 2001 Dec 1;167(11):6583-92.
4.
Polymorphisms in the interleukin 4, interleukin 13, and corresponding receptor genes are not associated with systemic sclerosis and do not influence gene expression.
Broen JC, etal., J Rheumatol. 2012 Jan;39(1):112-8. doi: 10.3899/jrheum.110235. Epub 2011 Nov 1.
5.
Upregulation of interleukin-13 receptor chains in bronchial smooth muscle tissues of mouse experimental asthma.
Chiba Y, etal., J Smooth Muscle Res. 2010;46(1):49-55.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
Schistosomiasis-induced experimental pulmonary hypertension: role of interleukin-13 signaling.
Graham BB, etal., Am J Pathol. 2010 Sep;177(3):1549-61. Epub 2010 Jul 29.
9.
IL-13 is pivotal in the fibro-obliterative process of bronchiolitis obliterans syndrome.
Keane MP, etal., J Immunol. 2007 Jan 1;178(1):511-9.
10.
Gene-gene interaction between IL-13 and IL-13Ralpha1 is associated with total IgE in Korean children with atopic asthma.
Kim HB, etal., J Hum Genet. 2006;51(12):1055-62. Epub 2006 Sep 28.
11.
Genetic association studies of interleukin-13 receptor alpha1 subunit gene polymorphisms in asthma and atopy.
Konstantinidis AK, etal., Eur Respir J. 2007 Jul;30(1):40-7. Epub 2007 Mar 28.
12.
Analysis of polymorphisms in olive pollen allergy: IL13, IL4RA, IL5 and ADRB2 genes.
Llanes E, etal., Int Arch Allergy Immunol. 2009;148(3):228-38. doi: 10.1159/000161583. Epub 2008 Oct 10.
13.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
14.
Distinct roles for IL-13 and IL-4 via IL-13 receptor alpha1 and the type II IL-4 receptor in asthma pathogenesis.
Munitz A, etal., Proc Natl Acad Sci U S A. 2008 May 20;105(20):7240-5. Epub 2008 May 14.
15.
Limited systemic sclerosis patients with pulmonary arterial hypertension show biomarkers of inflammation and vascular injury.
Pendergrass SA, etal., PLoS One. 2010 Aug 17;5(8):e12106.
16.
Expression of a functional IL-13Ralpha1 by rat B cells.
Pierrot C, etal., Biochem Biophys Res Commun 2001 Oct 5;287(4):969-76.
17.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
18.
GOA pipeline
RGD automated data pipeline
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
Comprehensive gene review and curation
RGD comprehensive gene curation
21.
Up-regulation of interleukin-13 receptor alpha1 on human keratinocytes in the skin of psoriasis and atopic dermatitis.
Wongpiyabovorn J, etal., J Dermatol Sci. 2003 Oct;33(1):31-40.
Il13ra1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 120,213,670 - 120,294,777 (+) NCBI GRCr8 mRatBN7.2 X 115,348,822 - 115,408,682 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 71,254,928 - 71,258,678 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl X 115,348,860 - 115,408,681 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 117,450,135 - 117,510,865 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 121,019,209 - 121,079,947 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 118,565,417 - 118,626,152 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 122,724,081 - 122,783,801 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 122,724,129 - 122,781,479 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 122,873,725 - 122,933,124 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 8,758,662 - 8,820,545 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 8,764,214 - 8,826,101 (-) NCBI Celera X 114,585,012 - 114,644,379 (+) NCBI Celera Cytogenetic Map X q34 NCBI
IL13RA1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 118,727,606 - 118,805,228 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 118,727,133 - 118,794,535 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 117,861,569 - 117,928,496 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 117,745,587 - 117,812,524 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 117,643,440 - 117,710,378 NCBI Celera X 118,316,317 - 118,383,340 (+) NCBI Celera Cytogenetic Map X q24 NCBI HuRef X 107,355,737 - 107,421,582 (+) NCBI HuRef CHM1_1 X 117,772,468 - 117,839,397 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 117,105,336 - 117,182,975 (+) NCBI T2T-CHM13v2.0
Il13ra1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 35,375,761 - 35,434,915 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 35,375,763 - 35,434,912 (+) Ensembl GRCm39 Ensembl GRCm38 X 36,112,108 - 36,171,262 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 36,112,110 - 36,171,259 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 33,652,134 - 33,711,257 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 32,543,584 - 32,602,707 (+) NCBI MGSCv36 mm8 Celera X 22,841,197 - 22,900,025 (+) NCBI Celera Cytogenetic Map X A3.3 NCBI cM Map X 20.49 NCBI
Il13ra1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955534 1,160,340 - 1,204,911 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955534 1,157,758 - 1,205,158 (-) NCBI ChiLan1.0 ChiLan1.0
IL13RA1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 118,085,884 - 118,164,235 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 118,089,492 - 118,167,836 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 107,735,233 - 107,813,282 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 118,195,828 - 118,269,449 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 118,202,285 - 118,266,770 (+) Ensembl panpan1.1 panPan2
IL13RA1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 90,925,497 - 90,981,855 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 90,924,801 - 90,979,963 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 77,001,059 - 77,055,772 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 92,665,536 - 92,720,247 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 92,665,506 - 92,720,247 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 90,118,717 - 90,173,430 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 91,877,457 - 91,932,160 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 91,605,785 - 91,660,491 (+) NCBI UU_Cfam_GSD_1.0
Il13ra1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 89,878,479 - 89,937,244 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936479 11,050,249 - 11,108,909 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936479 11,052,077 - 11,108,915 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
IL13RA1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 97,300,466 - 97,356,133 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 97,300,960 - 97,353,754 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 114,333,596 - 114,386,429 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IL13RA1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666065 31,471,060 - 31,545,965 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Il13ra1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 825 Count of miRNA genes: 309 Interacting mature miRNAs: 421 Transcripts: ENSRNOT00000017746 Prediction methods: Microtar, Miranda, Pita, Pita,Targetscan, Targetscan Result types: miRGate_prediction
1598872 Memor14 Memory QTL 14 4.5 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 97528096 142528096 Rat 1598856 Memor1 Memory QTL 1 1.9 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) X 120028026 141353710 Rat 1598809 Memor15 Memory QTL 15 4.4 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 120028026 141353710 Rat 738025 Stresp3 Stress response QTL 3 4.61 0.0066 stress-related behavior trait (VT:0010451) defensive burying - approach X 105359969 157758123 Rat 61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 80434318 125434318 Rat 61431 Cia19 Collagen induced arthritis QTL 19 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 105468858 125434318 Rat 10059603 Bw174 Body weight QTL 174 3.4 0.025 body mass (VT:0001259) body weight (CMO:0000012) X 118973754 157758123 Rat 2302047 Pia34 Pristane induced arthritis QTL 34 5.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 19 96916163 141916163 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
12
12
54
56
48
24
12
24
12
95
48
30
11
31
24
Too many to show, limit is 500. Download them if you would like to view them all.
RefSeq Acc Id:
NM_145789 ⟹ NP_665732
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 120,214,605 - 120,274,461 (+) NCBI mRatBN7.2 X 115,348,822 - 115,408,682 (+) NCBI Rnor_6.0 X 122,724,081 - 122,783,801 (+) NCBI Rnor_5.0 X 122,873,725 - 122,933,124 (+) NCBI RGSC_v3.4 X 8,758,662 - 8,820,545 (-) RGD Celera X 114,585,012 - 114,644,379 (+) RGD
Sequence:
GAGACTGCCGCGGCTCCAGCCGGGCCGGGCTCGGAGGCGAGGGGCTGCATGGCGCGGCCAGCGTGGCTGGGCGAGCTGTTGGTGCTGCTGCTTTTTGCCGCCTCCCTGGACCAAGTTGCCCTGGCCAC AGAAGTTCAGCCACCTGTAACGAATTTGAGTGTCTCTGTCGAAAATCTCTGCACAATAGTGTGGACATGGAGTCCTCCTGAGGGAGCCAGTCCAAATTGCAGTCTCAGATATTTTAGTCATTTTGATG ACCAACAGGATAAGAAAATTGCTCCTGAAACTCGTCGTAAAAAGGAATTACCCCTAAATGAGAAAATCTGTCTGCAAGTGGGGTCCCAGTGTAGCACCAATGAAAGTGAGAAGCCTAGCCCTTTGGTG AAAAAGTGCATCTCACCCCCCGAAGGGGATCCTGAGTCTGCTGTGACCGAACTGCAGTGCATTTGGCACAACCTGAGCTATATGAAGTGTTCCTGGCTCCCTGGAAAGAATACAAGCCCGGACACCAA CTATACTCTTTACTATTGGTACAGCAGCCTGGGGAAAAGTCTTCAATGTGAAAACATCCACAGAGAAGGTCAACACATTGGTTGTTCCTTTAAATTGACTAAAGTGGAATCTAATTATGAACATCATA ACATTCAGATAATGGTCAAGGATAATGCTGGGAAAATTAGGCCATCCTACAAAATAGTGTCCTTCACTTCCAATGTGAAACCCGGTCCTCCACATATTAAACATCTTTTCCTCAAAAATGGTGCCTTA TTCGTGCAGTGGAAGAACCCACAGAATTTCAGTAGCAGATGTTTGTCTTATGAAGTAGAAGTCAATAGCACTCAAACTGACAGCTATAATTCTAACTCTTTAGAGGTTGAAGAGGACAAATGCCAGAA TTCTGAATTTGATAGAAACATGGAGGGTGCAAGTTGTTTCATATCTCCCGGTGTTCTTGCCAACACTGTCTACACAGTCAGAGTAAGAGTCAAAACAAACAAGTTATGCTTTGATGACAACGACCTGT GGAGTAATTGGAGCGAAGCGCTGAGTATAGGTAAGGAGCCGAATTCCACCTTCTACACCACCATGTTACTCATCATTCCAGTCTTTGTCGCAGTGGTAATCATAATTCTCCTTTTTTACCTGAAAAGG CTTAAGATCATTATATTTCCTCCAATTCCTGATCCTGGCAAGATTTTTAAAGAAATGTTTGGAGACCAGAATGATGATACCCTGCACTGGAAAAAGTATGACATCTATGAGAAACAATCGAAAGAAGA AACCGACTCTGTAGTGCTGATAGAAAACCTGAAGAAAGCGGCTCCATGATGGGGACTCGAGATTTCTTTTTTGCCTTTAATGTGACCCTGTGAAGATTTATTGCATTCTCCATTTGTTATCTGGGGAC TCGTTAAATAGAAACTGAAACTACTCTTGAAAAACAGGCAGCTCCTAAGAGCCTCAGGTCTTGATGTGACTCTTGCACCAAAAATCCAAACTAAAGGAGCTCTTCAAGAAAAGCAGAGTTCTTCTCAT TCTTGCTCAATCCTAAAAGCAGATGTCCTTTGCAAAATCTCCAAACTAGAGGACAAAGAAAAGGGAGCAATGACCATGAATTCATCTTATCAGGAATTGTGACGGCTTCCTAAGGAATCTCTGCTTGC TCTGTATTCTTTGTGTGGAATAAGATCAAGAAATGTTTCTTGAGAGGAATTTCATTTGGGGTGTGTACACTAATGTTGTACTTACCACAGAACATCTAGCAAACAAAACTGATAGAATCTGCTGCCTA TTGTTCAGGAACCCACTGAGTAATATTTGTAGCTTTTAAACTACAATATCATTATCTACTTCAATAGCATTTTCCTCTGATTGGAAATTCCCAGAAATCATCTTGGACCATGGTAATGACACGTAGAG AAAAGGCATAGGCAACTTTTCCACCAAGGCTGATTTATGTCATTGCTTGTCTTTTAGGACAGTGGAGGCAGAATGAGGTAGTCTCTAATGATGGATGCTTACCTTTCATTTCTGCTACTCAAGTCAAG TATAGACTATGTATCTAGCTTGTGCCAAACCTTTAAGTATGAGGAGGGATGGGACCTCCCACCCATGGGTTTACATATATTTGGGGCTCCTTATTTTTCATCACCTTCTTTATCCCCCAGATAGGCAT TTCCGGACTTTTGAACTTCCCATCTTCTGTTTATGCCCCCATTGTGCCTACTCCCCCATCCTCTTTCTTGTAACCTTTTCACTCAGTGGAATTGAGGAGACAATTTTGCTTAGACTACCTAGTGGAGC AGGAAATACTCTGCATCTCAGGTAAAAAAAATGAGTAGACTGAACAACAATATGTAATTCATGCATATTTTACAACTTCCCTGTGAGCCTGCAATTTGAGATTTTCAAGCAATTGGTGTTTCTGTGTG TTTTCTAAATAGAGATGACGTCTTTTTTTTCCACTTAGAATTTAGCCCTATTTGCTTGAGAGGGGGAAAAAATAAGATTCATATCTGTTTCTCTTTGTTTGCAAAATAAGCCGTACAATGGCTGTTTT CTATGCTGTAAGTGGTCCTGTCAATTCTGTATTTTACTGAGAGGGAGGCAAGTGGAGCTCCAACTATGTGCTTGCTTTTTGCATATATTAGGTTTCCAATTCTATTCCCACAATATATGTTCATGTAC ATCCCCCCATTCTGACCATTTCCTGAAAATTTAAAACAGTGAGAGTTACACCCCCTTCTCTTTCTCCTACAGATCACTAGCCAGGACTGAAGCATTTGATATCAAAATTTTCCAGGCATGTATCAGTT CCTGTTAATAAAACGATACCAGTTGCATCTCTTGTTCTTAAGCAGGGCAGATAAGAGACCCCTGCTCTCCACAGGTTGGGACCACGGGGAACCTTGCTTGCCTGGTAGTGGAGGAGCATTGTGCCTGG AATTTCAGGAAATAGGGGAACATGGCACAATTGATGCCATTTCCTCCTGGCACTTTTTGGTATCAGATTGTGGCTGGGATACAGGCATTCTGGGTGTTGCAGTCTCCTATTAGTCAGTAGAAACAAGA CTTCGCTTTCTTGCATAAGTGTGAAATACTCCTTCCCCGGGGTATCATAGTTCTGAGAAGGAAAGCATCGTAAATGCCTTGTACAGAGCCATTGTTTACTACTGGCCTGTGTTGATGGAGCTGAAGAG CATGTTTTGAAATGCTCTGGAAACCGTCAATGCTGACAGTCTTACAGCATGGAAACAAAGACATCCTATTTTGCTTCAAATTCTCATTCAGAAGTACAGTAGCAGGGGGGAAGGGGACAGACAGCAAA TAGGAGTACCTTTGTTTTAACAGACAAAAGTAATCTCCAGGCCTTAAGAACTCTTCATGATATCAGTACATTGCTTATTGGTAACTTGTAAGTTCATATATTGACGAAGGTATATAGATTTTTCCCCA CTTACATACGTAAATCCAACATAAAGCGGACATTCCTACATTCCTTTCCTTTCATTCAGATGATGTTTCTGAATCTGGGCACTGAAGGGATGGCATACAATAATGTTAATGTTTTCAGTAATGTCTTC AACTAGGAGGCTTTCTGTTGAACTACTTATACAGAAGTAAAATAAATATTGTCTTTTTGTATGTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGG
hide sequence
RefSeq Acc Id:
XM_063279821 ⟹ XP_063135891
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 120,213,670 - 120,294,777 (+) NCBI
RefSeq Acc Id:
NP_665732 ⟸ NM_145789
- Peptide Label:
precursor
- UniProtKB:
Q561K3 (UniProtKB/TrEMBL), A0A0G2JZB2 (UniProtKB/TrEMBL), Q8VHC2 (UniProtKB/TrEMBL)
- Sequence:
MARPAWLGELLVLLLFAASLDQVALATEVQPPVTNLSVSVENLCTIVWTWSPPEGASPNCSLRYFSHFDDQQDKKIAPETRRKKELPLNEKICLQVGSQCSTNESEKPSPLVKKCISPPEGDPESAVT ELQCIWHNLSYMKCSWLPGKNTSPDTNYTLYYWYSSLGKSLQCENIHREGQHIGCSFKLTKVESNYEHHNIQIMVKDNAGKIRPSYKIVSFTSNVKPGPPHIKHLFLKNGALFVQWKNPQNFSSRCLS YEVEVNSTQTDSYNSNSLEVEEDKCQNSEFDRNMEGASCFISPGVLANTVYTVRVRVKTNKLCFDDNDLWSNWSEALSIGKEPNSTFYTTMLLIIPVFVAVVIIILLFYLKRLKIIIFPPIPDPGKIF KEMFGDQNDDTLHWKKYDIYEKQSKEETDSVVLIENLKKAAP
hide sequence
RefSeq Acc Id:
XP_063135891 ⟸ XM_063279821
- Peptide Label:
isoform X1
RGD ID: 13701978
Promoter ID: EPDNEW_R12501
Type: initiation region
Name: Il13ra1_1
Description: interleukin 13 receptor subunit alpha 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 122,724,066 - 122,724,126 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-16
Il13ra1
interleukin 13 receptor subunit alpha 1
Il13ra1
interleukin 13 receptor, alpha 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2004-09-10
Il13ra1
interleukin 13 receptor, alpha 1
Symbol and Name status set to approved
1299863
APPROVED
2003-02-27
Il13ra1
interleukin 13 receptor, alpha 1
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_domains
short intracellular domain with a proline rich motif and two conserved tyrosine residues
633067
gene_expression
mRNA and protein is expressed in rat B cells
633067
gene_homology
cDNA is 86.8% similar to mouse and 72.4% similar to the human gene
633067