Symbol:
F13a1
Name:
coagulation factor XIII A1 chain
RGD ID:
621495
Description:
Predicted to enable protein-glutamine gamma-glutamyltransferase activity. Predicted to be involved in blood coagulation, fibrin clot formation and peptide cross-linking. Predicted to act upstream of or within blood coagulation. Predicted to be located in cytoplasm and extracellular region. Biomarker of gastric ulcer. Human ortholog(s) of this gene implicated in artery disease (multiple); factor XIII deficiency; priapism; and thrombophilia (multiple). Orthologous to human F13A1 (coagulation factor XIII A chain); PARTICIPATES IN acenocoumarol pharmacodynamics pathway; alteplase pharmacodynamics pathway; aminocaproic acid pharmacodynamics pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 3,7-dihydropurine-6-thione.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
coagulation factor XIII A chain; coagulation factor XIII, A1 polypeptide; coagulation factor XIII, A1 subunit; coagulation factor XIIIa; F13a; protein-glutamine gamma-glutamyltransferase A chain; transglutaminase A chain
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
F13A1 (coagulation factor XIII A chain) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
F13a1 (coagulation factor XIII, A1 subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
F13a1 (coagulation factor XIII A chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
F13A1 (coagulation factor XIII A chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
F13A1 (coagulation factor XIII A chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
F13a1 (coagulation factor XIII A chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
F13A1 (coagulation factor XIII A chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
F13A1 (coagulation factor XIII A chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
F13a1 (coagulation factor XIII A chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TGM4 (transglutaminase 4) HGNC
Treefam
Alliance orthologs 3
Homo sapiens (human):
F13A1 (coagulation factor XIII A chain)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
F13a1 (coagulation factor XIII, A1 subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
f13a1a.1 (coagulation factor XIII, A1 polypeptide a, tandem duplicate 1)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
f13a1b (coagulation factor XIII, A1 polypeptide b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Tg
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 28,021,197 - 28,197,960 (+) NCBI GRCr8 mRatBN7.2 17 27,815,723 - 27,992,494 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 27,815,702 - 27,992,700 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 27,681,035 - 27,857,733 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 29,284,581 - 29,461,269 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 27,645,506 - 27,822,130 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 28,504,650 - 28,680,015 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 28,504,623 - 28,680,362 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 30,406,396 - 30,581,441 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 34,093,525 - 34,270,498 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 34,096,401 - 34,272,682 (+) NCBI Celera 17 27,443,244 - 27,619,724 (+) NCBI Celera Cytogenetic Map 17 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
F13a1 Rat (1->4)-beta-D-glucan multiple interactions ISO F13a1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of F13A1 mRNA CTD PMID:36331819 F13a1 Rat 1-chloro-2,4-dinitrobenzene decreases expression ISO F13A1 (Homo sapiens) 6480464 Dinitrochlorobenzene results in decreased expression of F13A1 mRNA CTD PMID:17374397 F13a1 Rat 1-naphthyl isothiocyanate affects response to substance ISO F13a1 (Mus musculus) 6480464 F13A1 protein affects the susceptibility to 1-Naphthylisothiocyanate CTD PMID:26921287 F13a1 Rat 17beta-estradiol affects expression ISO F13A1 (Homo sapiens) 6480464 Estradiol affects the expression of F13A1 mRNA CTD PMID:14699072 F13a1 Rat 17beta-estradiol increases expression ISO F13a1 (Mus musculus) 6480464 Estradiol results in increased expression of F13A1 mRNA CTD PMID:19484750 F13a1 Rat 17beta-estradiol multiple interactions ISO F13A1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of F13A1 mRNA and [Progesterone co-treated with Estradiol] results in decreased expression of F13A1 mRNA CTD PMID:17404688 and PMID:20660070 F13a1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 F13a1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO F13a1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of F13A1 mRNA CTD PMID:21570461 F13a1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of F13A1 mRNA CTD PMID:34747641 F13a1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of F13A1 mRNA CTD PMID:26232522 and PMID:32109520 F13a1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO F13A1 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 F13a1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO F13a1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 F13a1 Rat 3,4-methylenedioxymethamphetamine decreases methylation ISO F13a1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased methylation of F13A1 promoter CTD PMID:26251327 F13a1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO F13a1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of F13A1 mRNA CTD PMID:26251327 F13a1 Rat 3,7-dihydropurine-6-thione increases expression EXP 6480464 Mercaptopurine results in increased expression of F13A1 mRNA CTD PMID:23358152 F13a1 Rat 4,4'-sulfonyldiphenol increases expression ISO F13a1 (Mus musculus) 6480464 bisphenol S results in increased expression of F13A1 mRNA CTD PMID:30951980 F13a1 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression ISO F13A1 (Homo sapiens) 6480464 Oxazolone results in decreased expression of F13A1 mRNA CTD PMID:17374397 F13a1 Rat 4-hydroxyphenyl retinamide decreases expression ISO F13a1 (Mus musculus) 6480464 Fenretinide results in decreased expression of F13A1 mRNA CTD PMID:28973697 F13a1 Rat aflatoxin B1 increases methylation ISO F13A1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of F13A1 intron CTD PMID:30157460 F13a1 Rat aldehydo-D-glucose multiple interactions ISO F13a1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of F13A1 mRNA CTD PMID:37567420 F13a1 Rat all-trans-retinoic acid decreases expression ISO F13A1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of F13A1 mRNA CTD PMID:23724009 F13a1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of F13A1 mRNA CTD PMID:16483693 F13a1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of F13A1 mRNA CTD PMID:30779732 F13a1 Rat antirheumatic drug decreases expression ISO F13A1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of F13A1 mRNA CTD PMID:24449571 F13a1 Rat arsenous acid increases expression ISO F13A1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of F13A1 mRNA CTD PMID:20458559 F13a1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of F13A1 gene CTD PMID:35440735 F13a1 Rat Azoxymethane multiple interactions ISO F13a1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of F13A1 mRNA CTD PMID:29950665 F13a1 Rat belinostat increases expression ISO F13A1 (Homo sapiens) 6480464 belinostat results in increased expression of F13A1 mRNA CTD PMID:27188386 F13a1 Rat benzene decreases expression ISO F13A1 (Homo sapiens) 6480464 Benzene results in decreased expression of F13A1 mRNA CTD PMID:19162166 F13a1 Rat benzo[a]pyrene increases expression ISO F13a1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of F13A1 mRNA CTD PMID:32417428 F13a1 Rat benzo[a]pyrene decreases methylation ISO F13a1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of F13A1 intron CTD PMID:27901495 F13a1 Rat benzo[a]pyrene decreases methylation ISO F13A1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of F13A1 3' UTR and Benzo(a)pyrene results in decreased methylation of F13A1 promoter CTD PMID:27901495 F13a1 Rat benzo[b]fluoranthene increases expression ISO F13a1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of F13A1 mRNA CTD PMID:26377693 F13a1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO F13a1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of F13A1 mRNA CTD PMID:34319233 F13a1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of F13A1 mRNA CTD PMID:25181051 more ... F13a1 Rat bisphenol A increases expression ISO F13a1 (Mus musculus) 6480464 bisphenol A results in increased expression of F13A1 mRNA CTD PMID:32156529 F13a1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of F13A1 mRNA CTD PMID:33296240 F13a1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of F13A1 gene CTD PMID:28505145 F13a1 Rat bisphenol F increases expression ISO F13a1 (Mus musculus) 6480464 bisphenol F results in increased expression of F13A1 mRNA CTD PMID:30951980 F13a1 Rat calcitriol decreases expression ISO F13A1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of F13A1 mRNA CTD PMID:26485663 F13a1 Rat cantharidin decreases expression ISO F13a1 (Mus musculus) 6480464 Cantharidin results in decreased expression of F13A1 mRNA CTD PMID:36907384 F13a1 Rat carbon nanotube increases expression ISO F13a1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 F13a1 Rat CGP 52608 multiple interactions ISO F13A1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to F13A1 gene] CTD PMID:28238834 F13a1 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of F13A1 mRNA CTD PMID:23125180 F13a1 Rat chrysene increases expression ISO F13a1 (Mus musculus) 6480464 chrysene results in increased expression of F13A1 mRNA CTD PMID:26377693 F13a1 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of F13A1 mRNA CTD PMID:30556269 F13a1 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of F13A1 mRNA CTD PMID:30556269 F13a1 Rat D-glucose multiple interactions ISO F13a1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of F13A1 mRNA CTD PMID:37567420 F13a1 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of F13A1 mRNA CTD PMID:23640034 F13a1 Rat dextran sulfate multiple interactions ISO F13a1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of F13A1 mRNA CTD PMID:29950665 F13a1 Rat diarsenic trioxide increases expression ISO F13A1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of F13A1 mRNA CTD PMID:20458559 F13a1 Rat diclofenac increases expression ISO F13a1 (Mus musculus) 6480464 Diclofenac results in increased expression of F13A1 mRNA CTD PMID:26934552 F13a1 Rat diethyl phthalate decreases expression EXP 6480464 diethyl phthalate results in decreased expression of F13A1 mRNA CTD PMID:32341500 F13a1 Rat dioxygen multiple interactions ISO F13a1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of F13A1 mRNA CTD PMID:30529165 F13a1 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of F13A1 mRNA CTD PMID:33729688 F13a1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of F13A1 mRNA CTD PMID:25152437 F13a1 Rat dorsomorphin multiple interactions ISO F13A1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of F13A1 mRNA CTD PMID:27188386 F13a1 Rat doxorubicin decreases expression ISO F13A1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of F13A1 mRNA CTD PMID:29803840 F13a1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of F13A1 mRNA CTD PMID:29391264 F13a1 Rat ethanol multiple interactions ISO F13a1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of F13A1 mRNA CTD PMID:30517762 F13a1 Rat eugenol decreases expression ISO F13A1 (Homo sapiens) 6480464 Eugenol results in decreased expression of F13A1 mRNA CTD PMID:17374397 F13a1 Rat fructose multiple interactions ISO F13a1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of F13A1 mRNA CTD PMID:37567420 F13a1 Rat genistein decreases expression ISO F13a1 (Mus musculus) 6480464 Genistein results in decreased expression of F13A1 mRNA CTD PMID:32186404 F13a1 Rat glucose multiple interactions ISO F13a1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of F13A1 mRNA CTD PMID:37567420 F13a1 Rat glyphosate multiple interactions ISO F13a1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of F13A1 mRNA CTD PMID:37567420 F13a1 Rat graphite affects expression EXP 6480464 Graphite affects the expression of F13A1 mRNA CTD PMID:29933104 F13a1 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of F13A1 mRNA CTD PMID:22129741 F13a1 Rat inulin multiple interactions ISO F13a1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of F13A1 mRNA CTD PMID:36331819 F13a1 Rat iron atom decreases expression ISO F13A1 (Homo sapiens) 6480464 Iron deficiency results in decreased expression of F13A1 mRNA CTD PMID:20368581 F13a1 Rat iron(0) decreases expression ISO F13A1 (Homo sapiens) 6480464 Iron deficiency results in decreased expression of F13A1 mRNA CTD PMID:20368581 F13a1 Rat isoprenaline increases expression ISO F13a1 (Mus musculus) 6480464 Isoproterenol results in increased expression of F13A1 mRNA CTD PMID:20003209 F13a1 Rat ivermectin decreases expression ISO F13A1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of F13A1 protein CTD PMID:32959892 F13a1 Rat lead diacetate increases expression ISO F13A1 (Homo sapiens) 6480464 lead acetate results in increased expression of F13A1 mRNA CTD PMID:27562236 F13a1 Rat medroxyprogesterone acetate increases expression ISO F13A1 (Homo sapiens) 6480464 Medroxyprogesterone Acetate results in increased expression of F13A1 mRNA CTD PMID:20843944 F13a1 Rat mercaptopurine increases expression EXP 6480464 Mercaptopurine results in increased expression of F13A1 mRNA CTD PMID:23358152 F13a1 Rat metacetamol decreases expression ISO F13a1 (Mus musculus) 6480464 3-hydroxyacetanilide results in decreased expression of F13A mRNA CTD PMID:18544908 F13a1 Rat methotrexate decreases expression ISO F13A1 (Homo sapiens) 6480464 Methotrexate results in decreased expression of F13A1 mRNA CTD PMID:24449571 F13a1 Rat mifepristone increases expression ISO F13A1 (Homo sapiens) 6480464 Mifepristone results in increased expression of F13A1 mRNA CTD PMID:17584828 F13a1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of F13A1 gene CTD PMID:33148267 F13a1 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of F13A1 mRNA CTD PMID:22129741 F13a1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of F13A1 mRNA CTD PMID:22129741 F13a1 Rat nickel sulfate decreases expression ISO F13A1 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of F13A1 mRNA CTD PMID:16780908 and PMID:17374397 F13a1 Rat nitrates multiple interactions ISO F13a1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of F13A1 mRNA CTD PMID:35964746 F13a1 Rat ozone increases expression ISO F13a1 (Mus musculus) 6480464 Ozone results in increased expression of F13A1 mRNA CTD PMID:31626304 and PMID:33026818 F13a1 Rat ozone multiple interactions ISO F13a1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of F13A1 mRNA CTD PMID:34911549 F13a1 Rat paclitaxel increases expression EXP 6480464 Paclitaxel results in increased expression of F13A1 mRNA CTD PMID:18754875 F13a1 Rat paracetamol affects expression ISO F13a1 (Mus musculus) 6480464 Acetaminophen affects the expression of F13A1 mRNA CTD PMID:17562736 F13a1 Rat paracetamol increases expression ISO F13a1 (Mus musculus) 6480464 Acetaminophen results in increased expression of F13A mRNA CTD PMID:18544908 F13a1 Rat paraquat multiple interactions ISO F13A1 (Homo sapiens) 6480464 [Paraquat co-treated with Antigens and Dermatophagoides] results in decreased expression of F13A1 mRNA CTD PMID:34097952 F13a1 Rat perfluorohexanesulfonic acid increases expression ISO F13a1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of F13A1 mRNA CTD PMID:37995155 F13a1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO F13a1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of F13A1 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of F13A1 mRNA CTD PMID:36331819 F13a1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of F13A1 gene CTD PMID:33148267 F13a1 Rat phenylmercury acetate increases expression ISO F13A1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of F13A1 mRNA CTD PMID:26272509 F13a1 Rat phenylmercury acetate multiple interactions ISO F13A1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of F13A1 mRNA CTD PMID:27188386 F13a1 Rat pravastatin decreases expression ISO F13a1 (Mus musculus) 6480464 Pravastatin results in decreased expression of F13A1 mRNA CTD PMID:27225895 F13a1 Rat pravastatin decreases expression EXP 6480464 Pravastatin results in decreased expression of F13A1 mRNA CTD PMID:27225895 F13a1 Rat progesterone multiple interactions ISO F13A1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of F13A1 mRNA and [Progesterone co-treated with Estradiol] results in decreased expression of F13A1 mRNA CTD PMID:17404688 and PMID:20660070 F13a1 Rat purine-6-thiol increases expression EXP 6480464 Mercaptopurine results in increased expression of F13A1 mRNA CTD PMID:23358152 F13a1 Rat raloxifene affects expression ISO F13A1 (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of F13A1 mRNA CTD PMID:14699072 F13a1 Rat resveratrol increases expression ISO F13a1 (Mus musculus) 6480464 resveratrol results in increased expression of F13A1 mRNA CTD PMID:25280562 F13a1 Rat SB 431542 multiple interactions ISO F13A1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of F13A1 mRNA CTD PMID:27188386 F13a1 Rat senecionine increases expression ISO F13a1 (Mus musculus) 6480464 senecionine results in increased expression of F13A1 protein CTD PMID:35357534 F13a1 Rat silicon dioxide increases expression ISO F13a1 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of F13A1 mRNA CTD PMID:23221170 F13a1 Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of F13A1 mRNA CTD PMID:32721576 F13a1 Rat sodium arsenite decreases expression ISO F13a1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of F13A1 mRNA CTD PMID:37682722 F13a1 Rat succimer multiple interactions ISO F13A1 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of F13A1 mRNA CTD PMID:26378955 F13a1 Rat sulforaphane decreases expression ISO F13A1 (Homo sapiens) 6480464 sulforaphane results in decreased expression of F13A1 mRNA CTD PMID:26833863 F13a1 Rat tamoxifen affects expression ISO F13A1 (Homo sapiens) 6480464 Tamoxifen affects the expression of F13A1 mRNA CTD PMID:14699072 F13a1 Rat tamoxifen multiple interactions ISO F13A1 (Homo sapiens) 6480464 ESR2 protein affects the reaction [Tamoxifen results in decreased expression of F13A1 mRNA] CTD PMID:14699072 F13a1 Rat tebuconazole decreases expression ISO F13A1 (Homo sapiens) 6480464 tebuconazole results in decreased expression of F13A1 mRNA CTD PMID:30458266 F13a1 Rat tetrachloromethane increases expression ISO F13a1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of F13A1 mRNA CTD PMID:27339419 and PMID:31919559 F13a1 Rat tetrachloromethane multiple interactions ISO F13a1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of F13A1 mRNA CTD PMID:30517762 F13a1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of F13A1 mRNA CTD PMID:34492290 F13a1 Rat titanium dioxide increases expression ISO F13a1 (Mus musculus) 6480464 titanium dioxide results in increased expression of F13A1 mRNA CTD PMID:23557971 F13a1 Rat titanium dioxide decreases expression ISO F13a1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of F13A1 mRNA CTD PMID:35295148 F13a1 Rat titanium dioxide multiple interactions ISO F13a1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of F13A1 mRNA CTD PMID:29950665 F13a1 Rat tremolite asbestos increases expression ISO F13a1 (Mus musculus) 6480464 tremolite results in increased expression of F13A1 mRNA CTD PMID:29279043 F13a1 Rat tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of F13A1 mRNA CTD PMID:21683754 F13a1 Rat triphenyl phosphate affects expression ISO F13A1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of F13A1 mRNA CTD PMID:37042841 F13a1 Rat triptonide increases expression ISO F13a1 (Mus musculus) 6480464 triptonide results in increased expression of F13A1 mRNA CTD PMID:33045310 F13a1 Rat troglitazone increases expression ISO F13a1 (Mus musculus) 6480464 troglitazone results in increased expression of F13A1 mRNA CTD PMID:28973697 F13a1 Rat tungsten decreases expression ISO F13a1 (Mus musculus) 6480464 Tungsten results in decreased expression of F13A1 mRNA CTD PMID:30912803 F13a1 Rat valproic acid decreases expression ISO F13A1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of F13A1 protein CTD PMID:12859294 F13a1 Rat valproic acid affects expression ISO F13A1 (Homo sapiens) 6480464 Valproic Acid affects the expression of F13A1 mRNA CTD PMID:25979313 F13a1 Rat valproic acid increases expression ISO F13A1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of F13A1 mRNA CTD PMID:23179753 F13a1 Rat vitamin D affects expression ISO F13A1 (Homo sapiens) 6480464 Vitamin D affects the expression of F13A1 mRNA CTD PMID:20368581 F13a1 Rat vorinostat increases expression ISO F13A1 (Homo sapiens) 6480464 vorinostat results in increased expression of F13A1 mRNA CTD PMID:27188386 F13a1 Rat zaragozic acid A affects expression EXP 6480464 squalestatin 1 affects the expression of F13A1 mRNA CTD PMID:27225895 F13a1 Rat zaragozic acid A affects expression ISO F13a1 (Mus musculus) 6480464 squalestatin 1 affects the expression of F13A1 mRNA CTD PMID:27225895
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3,7-dihydropurine-6-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-hydroxyphenyl retinamide (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) arsenous acid (ISO) atrazine (EXP) Azoxymethane (ISO) belinostat (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) calcitriol (ISO) cantharidin (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroprene (EXP) chrysene (ISO) copper atom (EXP) copper(0) (EXP) D-glucose (ISO) decabromodiphenyl ether (EXP) dextran sulfate (ISO) diarsenic trioxide (ISO) diclofenac (ISO) diethyl phthalate (EXP) dioxygen (EXP,ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) eugenol (ISO) fructose (ISO) genistein (ISO) glucose (ISO) glyphosate (ISO) graphite (EXP) indole-3-methanol (EXP) inulin (ISO) iron atom (ISO) iron(0) (ISO) isoprenaline (ISO) ivermectin (ISO) lead diacetate (ISO) medroxyprogesterone acetate (ISO) mercaptopurine (EXP) metacetamol (ISO) methotrexate (ISO) mifepristone (ISO) N,N-diethyl-m-toluamide (EXP) N-acetyl-L-cysteine (EXP) N-nitrosodiethylamine (EXP) nickel sulfate (ISO) nitrates (ISO) ozone (ISO) paclitaxel (EXP) paracetamol (ISO) paraquat (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) phenylmercury acetate (ISO) pravastatin (EXP,ISO) progesterone (ISO) purine-6-thiol (EXP) raloxifene (ISO) resveratrol (ISO) SB 431542 (ISO) senecionine (ISO) silicon dioxide (EXP,ISO) sodium arsenite (ISO) succimer (ISO) sulforaphane (ISO) tamoxifen (ISO) tebuconazole (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) tremolite asbestos (ISO) tributylstannane (EXP) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) valproic acid (ISO) vitamin D (ISO) vorinostat (ISO) zaragozic acid A (EXP,ISO)
1.
The Arg703Trp missense mutation in F13A1 is a de novo event.
Anwar R and Langlois S, Br J Haematol. 2009 Jun;146(1):118-20. doi: 10.1111/j.1365-2141.2009.07700.x. Epub 2009 Apr 27.
2.
Identification of a point mutation in factor XIII A subunit deficiency.
Board P, etal., Blood 1992 Aug 15;80(4):937-41.
3.
Increased prevalence of microthromboses in retinal capillaries of diabetic individuals.
Boeri D, etal., Diabetes. 2001 Jun;50(6):1432-9.
4.
Combined carrier status of prothrombin 20210A and factor XIII-A Leu34 alleles as a strong risk factor for myocardial infarction: evidence of a gene-gene interaction.
Butt C, etal., Blood. 2003 Apr 15;101(8):3037-41. Epub 2002 Dec 12.
5.
Association of a common polymorphism in the factor XIII gene with venous thrombosis.
Catto AJ, etal., Blood. 1999 Feb 1;93(3):906-8.
6.
Factor XIII Val 34 Leu: a novel association with primary intracerebral hemorrhage.
Catto AJ, etal., Stroke. 1998 Apr;29(4):813-6.
7.
Factor XIII Val34Leu polymorphism in primary intracerebral haemorrhage.
Corral J, etal., Hematol J. 2000;1(4):269-73.
8.
Factor XIII improves gastric stress lesions in rats.
D'Argenio G, etal., Digestion 2001;63(4):220-8.
9.
Genetic polymorphisms associated with priapism in sickle cell disease.
Elliott L, etal., Br J Haematol. 2007 May;137(3):262-7.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
A common mutation in the gene for coagulation factor XIII-A (VAL34Leu): a risk factor for primary intracerebral hemorrhage is protective against atherothrombotic diseases.
Gemmati D, etal., Am J Hematol. 2001 Jul;67(3):183-8.
12.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
13.
A common F13A1 intron 1 variant IVS1+12(A) is associated with mild FXIII deficiency in Caucasian population.
Ivaskevicius V, etal., Ann Hematol. 2013 Jul;92(7):975-9. doi: 10.1007/s00277-013-1724-2. Epub 2013 Mar 19.
14.
Identification of eight novel coagulation factor XIII subunit A mutations: implied consequences for structure and function.
Ivaskevicius V, etal., Haematologica. 2010 Jun;95(6):956-62. doi: 10.3324/haematol.2009.017210. Epub 2010 Feb 23.
15.
Factor XIII deficiency: complete phenotypic characterization of two cases with novel causative mutations.
Katona E, etal., Haemophilia. 2014 Jan;20(1):114-20. doi: 10.1111/hae.12267. Epub 2013 Oct 1.
16.
Leukemic lymphoblasts, a novel expression site of coagulation factor XIII subunit A.
Kiss F, etal., Thromb Haemost. 2006 Aug;96(2):176-82.
17.
Factor XIII A subunit-deficient mice developed severe uterine bleeding events and subsequent spontaneous miscarriages.
Koseki-Kuno S, etal., Blood. 2003 Dec 15;102(13):4410-2. Epub 2003 Aug 21.
18.
Role of blood coagulation factor XIII in patients with acute pulmonary embolism. Correlation of factor XIII antigen levels with pulmonary occlusion rate, fibrinogen, D-dimer, and clot firmness.
Kucher N, etal., Thromb Haemost. 2003 Sep;90(3):434-8.
19.
Targeted inactivation of the mouse locus encoding coagulation factor XIII-A: hemostatic abnormalities in mutant mice and characterization of the coagulation deficit.
Lauer P, etal., Thromb Haemost. 2002 Dec;88(6):967-74.
20.
Congenital factor XIII deficiency caused by two mutations in eight Tunisian families: molecular confirmation of a founder effect.
Louhichi N, etal., Ann Hematol. 2010 May;89(5):499-504. doi: 10.1007/s00277-009-0863-y. Epub 2009 Nov 24.
21.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
22.
Deficiency in the A-subunit of coagulation factor XIII: two novel point mutations demonstrate different effects on transcript levels.
Mikkola H, etal., Blood. 1994 Jul 15;84(2):517-25.
23.
Reduction of REM sleep by a tryptophan-free amino acid diet.
Moja EA, etal., Life Sci 1979 Apr 16;24(16):1467-70.
24.
Fibrinogen and fibrin structure and functions.
Mosesson MW J Thromb Haemost. 2005 Aug;3(8):1894-904.
25.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
26.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
27.
Deficiency of blood coagulation factor XIII in Crohn's disease.
Oshitani N, etal., Am J Gastroenterol. 1995 Jul;90(7):1116-8.
28.
Biulleten' eksperimental'noi biologii i meditsiny
Pastorova VE, etal., Biull Eksp Biol Med. 1979 Feb;87(2):99-101.
29.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
30.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
31.
Polymorphisms of coagulation factor XIII subunit A and risk of nonfatal hemorrhagic stroke in young white women.
Reiner AP, etal., Stroke. 2001 Nov;32(11):2580-6.
32.
The V34L polymorphism of factor XIII and peripheral arterial disease.
Renner W, etal., Int Angiol. 2002 Mar;21(1):53-7.
33.
GOA pipeline
RGD automated data pipeline
34.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
35.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
36.
Comprehensive gene review and curation
RGD comprehensive gene curation
37.
Plasma factor XIII activity in patients with disseminated intravascular coagulation.
Song JW, etal., Yonsei Med J. 2006 Apr 30;47(2):196-200.
38.
Critical role of factor XIII in the initial stages of carbon tetrachloride-induced adult liver remodeling.
Tsujimoto I, etal., Am J Pathol. 2011 Dec;179(6):3011-9. doi: 10.1016/j.ajpath.2011.08.037. Epub 2011 Oct 19.
39.
Factor XIII Val34Leu polymorphism, factor XIII antigen levels and activity and the risk of deep venous thrombosis.
Van Hylckama Vlieg A, etal., Br J Haematol. 2002 Oct;119(1):169-75.
40.
Homozygous intronic mutation leading to inefficient transcription combined with a novel frameshift mutation in F13A1 gene causes FXIII deficiency.
Wang W, etal., J Hum Genet. 2011 Jun;56(6):460-3. doi: 10.1038/jhg.2011.41. Epub 2011 Apr 21.
F13a1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 28,021,197 - 28,197,960 (+) NCBI GRCr8 mRatBN7.2 17 27,815,723 - 27,992,494 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 27,815,702 - 27,992,700 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 27,681,035 - 27,857,733 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 29,284,581 - 29,461,269 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 27,645,506 - 27,822,130 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 28,504,650 - 28,680,015 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 28,504,623 - 28,680,362 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 30,406,396 - 30,581,441 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 34,093,525 - 34,270,498 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 34,096,401 - 34,272,682 (+) NCBI Celera 17 27,443,244 - 27,619,724 (+) NCBI Celera Cytogenetic Map 17 p12 NCBI
F13A1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 6,144,084 - 6,320,662 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 6,144,084 - 6,321,013 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 6,144,317 - 6,320,895 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 6,089,310 - 6,265,923 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 6,089,316 - 6,265,901 NCBI Celera 6 7,372,733 - 7,550,578 (-) NCBI Celera Cytogenetic Map 6 p25.1 NCBI HuRef 6 6,020,217 - 6,197,010 (-) NCBI HuRef CHM1_1 6 6,146,854 - 6,323,031 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 6,013,258 - 6,189,597 (-) NCBI T2T-CHM13v2.0
F13a1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 37,051,150 - 37,234,220 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 37,051,152 - 37,234,220 (-) Ensembl GRCm39 Ensembl GRCm38 13 36,867,178 - 37,050,244 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 36,867,178 - 37,050,244 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 36,959,047 - 37,142,113 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 36,874,653 - 37,056,670 (-) NCBI MGSCv36 mm8 Celera 13 37,983,710 - 38,163,470 (-) NCBI Celera Cytogenetic Map 13 A3.3 NCBI cM Map 13 14.44 NCBI
F13a1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955465 7,443,166 - 7,617,436 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955465 7,444,118 - 7,617,366 (+) NCBI ChiLan1.0 ChiLan1.0
F13A1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 20,772,261 - 20,960,421 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 16,776,810 - 16,955,131 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 5,978,505 - 6,156,705 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 6,159,012 - 6,337,000 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 6,157,926 - 6,513,961 (-) Ensembl panpan1.1 panPan2
F13A1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 6,186,750 - 6,347,522 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 6,187,235 - 6,349,773 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 35 6,191,814 - 6,354,808 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 35 6,267,724 - 6,430,557 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 35 6,267,724 - 6,428,774 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 35 6,122,455 - 6,285,137 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 6,148,410 - 6,311,467 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 7,481,872 - 7,644,350 (-) NCBI UU_Cfam_GSD_1.0
F13a1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 17,930,084 - 18,091,733 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936534 6,199,066 - 6,361,476 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936534 6,199,066 - 6,360,374 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
F13A1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 3,751,292 - 3,900,762 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 3,751,290 - 3,900,797 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 3,952,957 - 4,102,446 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
F13A1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 65,885,498 - 66,040,026 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 65,885,658 - 66,040,040 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 6,090,570 - 6,385,150 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
F13a1
.
Predicted Target Of
Count of predictions: 143 Count of miRNA genes: 110 Interacting mature miRNAs: 133 Transcripts: ENSRNOT00000021568 Prediction methods: Microtar, Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 2300002 Iddm36 Insulin dependent diabetes mellitus QTL 36 1.98 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 9991286 40540197 Rat 1354640 Scl32 Serum cholesterol level QTL 32 5.4 blood HDL cholesterol amount (VT:0000184) blood high density lipoprotein cholesterol level (CMO:0000052) 17 15781592 60781592 Rat 152023626 Bp403 Blood pressure QTL 403 3.86 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 1300123 Bp194 Blood pressure QTL 194 2.82 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 2115149 34551001 Rat 2302377 Scl61 Serum cholesterol level QTL 61 4.36 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 17 27389946 53481766 Rat 70157 Niddm32 Non-insulin dependent diabetes mellitus QTL 32 4.34 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 22454924 50909196 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 1354628 Stl13 Serum triglyceride level QTL 13 3.8 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 21293039 60781592 Rat 1581512 Cm55 Cardiac mass QTL 55 2.8 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 27027949 56836890 Rat 10401807 Kidm52 Kidney mass QTL 52 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 1 31701463 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 61394 Bp8 Blood pressure QTL 8 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 23080567 59555013 Rat 1559055 Bp278 Blood pressure QTL 278 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 68653184 Rat 152025238 Slep14 Serum leptin concentration QTL 14 4.62 blood leptin amount (VT:0005667) 17 24184890 79524188 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 1354613 Kidm14 Kidney mass QTL 14 6.2 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 17 4299130 35837242 Rat 1331765 Hrtrt15 Heart rate QTL 15 4.094 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 17 15330613 55836425 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 12903980 Cm120 Cardiac mass QTL 120 0.002 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 17 23653184 68653184 Rat 70184 BpQTLcluster14 Blood pressure QTL cluster 14 3.38 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 1 31990913 Rat 12903981 Am17 Aortic mass QTL 17 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 17 23653184 68653184 Rat 4889891 Eae32 Experimental allergic encephalomyelitis QTL 32 4.8 0.0002 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 17 27027949 36146731 Rat 4889955 Bss93 Bone structure and strength QTL 93 4.4 tibia size trait (VT:0100001) tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727) 17 27027949 60463643 Rat 2303561 Bw91 Body weight QTL 91 2 body mass (VT:0001259) body weight (CMO:0000012) 17 8868462 53868462 Rat 12903982 Kidm70 Kidney mass QTL 70 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 23653184 70974005 Rat 631207 Niddm41 Non-insulin dependent diabetes mellitus QTL 41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 17 1 37830672 Rat 12903978 Cm118 Cardiac mass QTL 118 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 17 23653184 68653184 Rat 12903979 Cm119 Cardiac mass QTL 119 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 23653184 68653184 Rat 1354619 Bp242 Blood pressure QTL 242 6.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 24599340 69599340 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 152023740 Bp406 Blood pressure QTL 406 6.06 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 7488966 Bp370 Blood pressure QTL 370 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 57246843 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 152023737 Bp405 Blood pressure QTL 405 5.06 arterial blood pressure trait (VT:2000000) 23930421 79524188 Rat 1354659 Scl68 Serum cholesterol level QTL 68 3.9 blood VLDL cholesterol amount (VT:0005144) blood very low density lipoprotein cholesterol level (CMO:0000648) 17 15781592 60781592 Rat 152023736 Bp404 Blood pressure QTL 404 3.78 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat
D17Rat13
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 17 28,040,628 - 28,040,791 (+) Marker Load Pipeline mRatBN7.2 17 27,835,154 - 27,835,317 (+) MAPPER mRatBN7.2 Rnor_6.0 17 28,523,806 - 28,523,968 NCBI Rnor6.0 Rnor_5.0 17 30,425,552 - 30,425,714 UniSTS Rnor5.0 RGSC_v3.4 17 34,113,131 - 34,113,294 RGD RGSC3.4 RGSC_v3.4 17 34,113,132 - 34,113,294 UniSTS RGSC3.4 RGSC_v3.1 17 34,115,973 - 34,116,135 RGD Celera 17 27,462,506 - 27,462,668 UniSTS RH 3.4 Map 17 353.9 RGD RH 3.4 Map 17 353.9 UniSTS RH 2.0 Map 17 236.5 RGD SHRSP x BN Map 17 21.7599 RGD FHH x ACI Map 17 28.9299 RGD Cytogenetic Map 17 p12 UniSTS
D17Got41
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 27,921,600 - 27,921,737 (+) MAPPER mRatBN7.2 Rnor_6.0 17 28,609,970 - 28,610,106 NCBI Rnor6.0 Rnor_5.0 17 30,511,396 - 30,511,532 UniSTS Rnor5.0 RGSC_v3.4 17 34,199,600 - 34,199,736 RGD RGSC3.4 RGSC_v3.4 17 34,199,601 - 34,199,737 UniSTS RGSC3.4 RGSC_v3.1 17 34,202,441 - 34,202,577 RGD Celera 17 27,548,846 - 27,548,982 UniSTS RH 3.4 Map 17 325.72 UniSTS RH 3.4 Map 17 325.72 RGD RH 2.0 Map 17 256.6 RGD Cytogenetic Map 17 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021568 ⟹ ENSRNOP00000021568
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 27,815,702 - 27,992,700 (+) Ensembl Rnor_6.0 Ensembl 17 28,504,623 - 28,680,362 (+) Ensembl
RefSeq Acc Id:
NM_021698 ⟹ NP_067730
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 28,021,197 - 28,197,960 (+) NCBI mRatBN7.2 17 27,815,723 - 27,992,494 (+) NCBI Rnor_6.0 17 28,504,650 - 28,680,015 (+) NCBI Rnor_5.0 17 30,406,396 - 30,581,441 (+) NCBI RGSC_v3.4 17 34,093,525 - 34,270,498 (+) RGD Celera 17 27,443,244 - 27,619,724 (+) RGD
Sequence:
TACCCAGAGGCACACGGGGAGACTACCAGAGCACCCTCTCAGGAGCACAAGCAGGATCCAGTAAAGCTGAAAATGTCGGATACTCCAGCAACTACCTTTGGGGGACGGCGAGCAATCCCACCCAACAA
hide sequence
RefSeq Acc Id:
NP_067730 ⟸ NM_021698
- UniProtKB:
O08619 (UniProtKB/Swiss-Prot), G3V811 (UniProtKB/TrEMBL), A6J7C8 (UniProtKB/TrEMBL)
- Sequence:
MSDTPATTFGGRRAIPPNNSNAAEVDLPTEDLQGLVPRGVSLKDYLNVTAVHLFKERWDSNKIDHHTDKYDNNKLIVRRGQTFYIQIDFNRPYDPRKDLFRVEYVIGRYPQENKGTYIPVPVVTELQS
hide sequence
Ensembl Acc Id:
ENSRNOP00000021568 ⟸ ENSRNOT00000021568
RGD ID: 13700399 Promoter ID: EPDNEW_R10922 Type: single initiation site Name: F13a1_1 Description: coagulation factor XIII A1 chain SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 28,504,629 - 28,504,689 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-27
F13a1
coagulation factor XIII A1 chain
F13a1
coagulation factor XIII, A1 polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-09
F13a1
coagulation factor XIII, A1 polypeptide
F13a1
coagulation factor XIII, A1 subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
F13a1
coagulation factor XIII, A1 subunit
F13a
Symbol updated
1299863 APPROVED
2005-01-20
F13a
coagulation factor XIII, A1 subunit
coagulation factor XIIIa
Name updated
1299863 APPROVED
2002-08-07
F13a
coagulation factor XIIIa
Symbol and Name status set to provisional
70820 PROVISIONAL
