Advanced Search (OLGA)

Gene: Crcp (CGRP receptor component) Rattus norvegicus

Analyze

Symbol:

Crcp

Name:

CGRP receptor component

RGD ID:

620753

Description:

Predicted to enable DNA-directed RNA polymerase activity and calcitonin gene-related peptide receptor activity. Predicted to be involved in transcription initiation at RNA polymerase III promoter. Predicted to act upstream of or within neuropeptide signaling pathway. Located in axon; dendrite; and neuronal cell body. Biomarker of sciatic neuropathy. Orthologous to human CRCP (CGRP receptor component); PARTICIPATES IN RNA polymerase III transcription pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

calcitonin gene-related peptide-receptor component; Cgrp-rcp; CGRP-receptor component protein; CGRPRCP; DNA-directed RNA polymerase III subunit RPC9; RNA polymerase III subunit C9

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CRCP (CGRP receptor component)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther, Treefam
Mus musculus (house mouse):	Crcp (calcitonin gene-related peptide-receptor component protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Crcp (CGRP receptor component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ASL (argininosuccinate lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CRCP (CGRP receptor component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Crcp (CGRP receptor component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CRCP (CGRP receptor component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CRCP (CGRP receptor component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Crcp (CGRP receptor component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Crcp (CGRP receptor component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Crcp (calcitonin gene-related peptide-receptor component protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CRCP (CGRP receptor component)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	crcp (calcitonin gene-related peptide-receptor component protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	M106.7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	M106.7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPC17	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPC17	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Rcp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Rcp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	crcp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	crcp	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	32,260,108 - 32,315,116 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	32,260,143 - 32,315,237 (-)	Ensembl				GRCr8
mRatBN7.2	12	26,623,968 - 26,659,756 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	26,623,976 - 26,768,225 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	27,771,819 - 27,807,416 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	28,382,334 - 28,417,945 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	27,443,177 - 27,479,412 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	30,125,237 - 30,160,857 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	30,125,168 - 30,180,115 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	32,061,753 - 32,097,619 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	27,666,950 - 27,702,741 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	28,337,894 - 28,373,498 (-)	NCBI		Celera
RGSC_v3.1	12	27,530,112 - 27,566,057 (-)	NCBI
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Hyperalgesia (IEP)

sciatic neuropathy (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (EXP)

cadmium dichloride (ISO)

calciol (ISO)

carbon nanotube (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

fenthion (ISO)

flavonoids (EXP)

flutamide (EXP)

fulvestrant (ISO)

geldanamycin (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

ketamine (EXP)

methimazole (EXP)

methotrexate (ISO)

methoxychlor (EXP)

nitrates (ISO)

nitrogen dioxide (ISO)

paracetamol (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

resveratrol (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

thimerosal (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

defense response to virus (IEA)

DNA-templated transcription initiation (IEA)

immune system process (IEA)

innate immune response (IEA)

neuropeptide signaling pathway (ISO)

termination of RNA polymerase III transcription (ISO)

transcription by RNA polymerase III (ISO,ISS)

transcription initiation at RNA polymerase III promoter (IBA,IEA,ISO)

Cellular Component

acrosomal vesicle (ISO)

axon (IDA)

dendrite (IDA)

DNA polymerase III complex (ISO,ISS)

DNA-directed RNA polymerase complex (IEA)

neuronal cell body (IDA)

nucleus (IEA)

plasma membrane (IEA)

RNA polymerase complex (IEA)

RNA polymerase III complex (IBA,IEA,ISO)

Molecular Function

calcitonin gene-related peptide receptor activity (ISO)

DNA-directed RNA polymerase activity (ISO,ISS)

nucleotide binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

RNA polymerase III transcription pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Peripheral calcitonin gene-related peptide receptor activation and mechanical sensitization of the joint in rat models of osteoarthritis pain.	Bullock CM, etal., Arthritis Rheumatol. 2014 Aug;66(8):2188-200. doi: 10.1002/art.38656.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits.	Hu P, etal., Mol Cell Biol. 2002 Nov;22(22):8044-55.
4.	Early maternal deprivation alters hippocampal levels of neuropeptide Y and calcitonin-gene related peptide in adult rats.	Husum H, etal., Neuropharmacology 2002 May;42(6):798-806.
5.	Effect of aging on the expression of adrenomedullin and its receptor component proteins in the male reproductive system of the rat.	Li YY, etal., J Gerontol A Biol Sci Med Sci. 2007 Dec;62(12):1346-51.
6.	Localization and modulation of calcitonin gene-related peptide-receptor component protein-immunoreactive cells in the rat central and peripheral nervous systems.	Ma W, etal., Neuroscience 2003;120(3):677-94.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Calcitonin gene-related peptide-receptor component protein expression in the uterine cervix, lumbosacral spinal cord, and dorsal root ganglia.	Pokabla MJ, etal., Peptides. 2002 Mar;23(3):507-14.
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:9322931	PMID:10067875	PMID:11804624	PMID:12482973	PMID:12837925	PMID:15486424	PMID:15489334	PMID:15756563	PMID:17287081	PMID:18186028	PMID:18332633	PMID:18364471
PMID:19581316	PMID:19864020	PMID:20162407	PMID:21719118	PMID:22074408	PMID:23958278	PMID:24321404	PMID:25687546

Genomics

Comparative Map Data

Crcp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	32,260,108 - 32,315,116 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	32,260,143 - 32,315,237 (-)	Ensembl				GRCr8
mRatBN7.2	12	26,623,968 - 26,659,756 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	26,623,976 - 26,768,225 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	27,771,819 - 27,807,416 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	28,382,334 - 28,417,945 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	27,443,177 - 27,479,412 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	30,125,237 - 30,160,857 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	30,125,168 - 30,180,115 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	32,061,753 - 32,097,619 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	27,666,950 - 27,702,741 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	28,337,894 - 28,373,498 (-)	NCBI		Celera
RGSC_v3.1	12	27,530,112 - 27,566,057 (-)	NCBI
Cytogenetic Map	12	q12	NCBI

CRCP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	66,114,818 - 66,154,568 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	66,114,604 - 66,154,568 (+)	Ensembl			hg38	GRCh38
GRCh37	7	65,579,805 - 65,619,555 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	65,217,240 - 65,256,990 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	7	66,494,042 - 66,533,870 (-)	NCBI		Celera
Cytogenetic Map	7	q11.21	NCBI
HuRef	7	61,767,024 - 61,819,799 (+)	NCBI		HuRef
CHM1_1	7	65,675,426 - 65,715,180 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	67,336,904 - 67,376,648 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	64,917,300 - 64,957,081 (+)	NCBI

Crcp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	130,058,147 - 130,089,628 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	130,058,131 - 130,089,630 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	130,029,306 - 130,060,787 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	130,029,290 - 130,060,789 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	130,505,176 - 130,536,657 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	130,314,009 - 130,345,490 (+)	NCBI		MGSCv36	mm8
Celera	5	127,033,447 - 127,067,402 (+)	NCBI		Celera
Cytogenetic Map	5	G1.3	NCBI
cM Map	5	68.42	NCBI

Crcp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	8,431,161 - 8,483,181 (+)	Ensembl
ChiLan1.0	NW_004955456	8,431,161 - 8,479,866 (+)	NCBI	ChiLan1.0	ChiLan1.0

ASL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	81,389,044 - 81,406,476 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	129,716,194 - 129,736,310 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	59,908,648 - 59,948,822 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	73,181,115 - 73,219,243 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	73,142,842 - 73,157,472 (+)	Ensembl			panPan2	panpan1.1
PanPan1.1 Ensembl	7	73,181,170 - 73,219,243 (+)	NCBI			panPan2	panpan1.1

CRCP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	806,892 - 843,066 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	806,744 - 842,424 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	2,506,855 - 2,542,170 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	611,479 - 646,826 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	611,484 - 648,558 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	555,026 - 590,343 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	548,968 - 584,286 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	720,464 - 756,055 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Crcp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	126,374,661 - 126,401,084 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	7,635,454 - 7,659,614 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	7,635,483 - 7,661,847 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CRCP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	16,584,311 - 16,622,069 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	16,528,949 - 16,622,005 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	16,776,960 - 16,874,417 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CRCP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	1,826,194 - 1,864,642 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	1,826,385 - 1,864,827 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666070	14,780,811 - 14,819,771 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Crcp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	8,431,970 - 8,469,765 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	8,431,986 - 8,470,264 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Crcp
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	23,928,276 - 23,954,553 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Crcp
600 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	117
Count of miRNA genes:	93
Interacting mature miRNAs:	105
Transcripts:	ENSRNOT00000001202
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	29775522	42298555	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	18749469	36488809	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	18749469	34312613	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	29636637	37764351	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	33700556	Rat

Markers in Region

D12Rat83

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	32,272,863 - 32,273,006 (+)	Marker Load Pipeline
mRatBN7.2	12	26,636,724 - 26,636,867 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	30,137,936 - 30,138,078	NCBI	Rnor6.0
Rnor_5.0	12	32,074,699 - 32,074,841	UniSTS	Rnor5.0
RGSC_v3.4	12	27,679,651 - 27,679,793	UniSTS	RGSC3.4
RGSC_v3.4	12	27,679,650 - 27,679,792	RGD	RGSC3.4
Celera	12	28,350,593 - 28,350,735	UniSTS
RGSC_v3.1	12	27,542,866 - 27,543,008	RGD
FHH x ACI Map	12	14.4999	UniSTS
FHH x ACI Map	12	14.4999	RGD
Cytogenetic Map	12	q13	UniSTS

BF388305

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	26,661,399 - 26,661,549 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	30,162,607 - 30,162,756	NCBI	Rnor6.0
Rnor_5.0	12	32,099,369 - 32,099,518	UniSTS	Rnor5.0
RGSC_v3.4	12	27,704,491 - 27,704,640	UniSTS	RGSC3.4
Celera	12	28,375,248 - 28,375,397	UniSTS
RH 3.4 Map	12	454.3	UniSTS
Cytogenetic Map	12	q13	UniSTS

RH135206

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	26,624,062 - 26,624,253 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	30,125,275 - 30,125,465	NCBI	Rnor6.0
Rnor_5.0	12	32,061,791 - 32,061,981	UniSTS	Rnor5.0
RGSC_v3.4	12	27,666,988 - 27,667,178	UniSTS	RGSC3.4
Celera	12	28,337,932 - 28,338,122	UniSTS
RH 3.4 Map	12	448.2	UniSTS
Cytogenetic Map	12	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053670	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC113710	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF103950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF440799	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC059117	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001202 ⟹ ENSRNOP00000001202

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,623,976 - 26,678,906 (-)	Ensembl
Rnor_6.0 Ensembl	12	30,125,168 - 30,180,115 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000079176 ⟹ ENSRNOP00000073151

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,624,972 - 26,659,750 (-)	Ensembl
Rnor_6.0 Ensembl	12	30,126,184 - 30,151,415 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000079546 ⟹ ENSRNOP00000070920

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,721,835 - 26,768,225 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104408 ⟹ ENSRNOP00000095977

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,623,976 - 26,768,225 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107624 ⟹ ENSRNOP00000084882

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,623,976 - 26,659,727 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109091 ⟹ ENSRNOP00000083764

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,721,773 - 26,768,225 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112952 ⟹ ENSRNOP00000078246

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,723,640 - 26,768,225 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119276 ⟹ ENSRNOP00000077096

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,623,976 - 26,647,471 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000120757 ⟹ ENSRNOP00000098382

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	32,260,143 - 32,295,867 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000120758 ⟹ ENSRNOP00000098383

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	32,260,143 - 32,283,592 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000136822 ⟹ ENSRNOP00000101135

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	32,260,143 - 32,315,237 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000157265 ⟹ ENSRNOP00000106353

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	32,261,112 - 32,295,867 (-)	Ensembl

RefSeq Acc Id:

NM_053670 ⟹ NP_446122

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	32,260,165 - 32,295,767 (-)	NCBI
mRatBN7.2	12	26,624,025 - 26,659,650 (-)	NCBI
Rnor_6.0	12	30,125,237 - 30,160,857 (-)	NCBI
Rnor_5.0	12	32,061,753 - 32,097,619 (-)	NCBI
RGSC_v3.4	12	27,666,950 - 27,702,741 (-)	RGD
Celera	12	28,337,894 - 28,373,498 (-)	RGD

Sequence:

show sequence

GAGGCAGAGGCAACATGGAAGTGAAGGATGCGAACGCTGCCCTGCTCAGTAACTACGAGGTGTT
CCAGTTACTGACAGACCTCAAAGAGCAGCGGAAGGAGAGCGGGAAGAACAAGCATAGCGCCGGG
CAGCAGAACTTGAACGCCATCACCTACGAGACATTAAAATACATATCGAAAACTCCATGTAAGA
ACCAGAGTCCGGCGATTGTCCAAGAATTCCTCACAGCAATGAAGAGCCACAAGCTGACCAAAGC
CGAGAAGCTTCAGCTGCTGAATCACAGGCCAATGACCGCTGTTGAGATCCAGCTGATGGTGGAA
GAGAGTGAAGAGCGGCTCACGGAGGAGCAGATTGAAGCTCTCCTGCACACTGTCACCAGCATCC
TGCCTGCAGGTCCAGAGGATGAGCAGAGCAAAAGCACTAGCAATGACGCGGCAATGGAAGAGGA
GGAGCCTGCATAGACATCTGTGGCCATTATGACACAGCTGGCCAGGTTGTTCGTGATGCTCAAA
GCCACAACAGCCATTTCCTGGACGTTCAGAGAACTGTTTATTCGGCCTGACCCCTCTCTCAAAT
ATTCCTGATCTCAGGATTGGTTGAGAAAAAAAATCACAAAAATAAGATGAAAAGAAATCTTTGT
GCCTTGGGTTCAAGAAACATGGGGTCAGAGAAGGGCAGAGGGCTCGAGATGGGGCAGCATGGCT
ATGCAGCCCTCTGGGTAGAAAGGCTTGTGTGGCCTCTGTCGCACTTGTACACAGTGGGGAGCTA
TTCAGGCACTTTGATGACTGTGTTGTAGGCAATGTCAGGCACCGCCATAGAATGGAGCTGGGGA
ACGACCTCAGACGGTCTCGAGCTCCCAGAGCTGCACACAGCTGCTCCAGGGGAAATGACCCAGG
GCTTAGCTCACGGTAGAGGAATGTCCTCGGCAGAGCAGGAGGCAAGGAAAGGAGATAAGAGGAA
ACTGCAGTCTGAGCCCAGCCTGGTGTACATAATAAGGAACACACATGTGAATATACCTAACACA
CATGCGTGCCACACACACACATACAAAGAAATTAGTCCCTTTTCTGTGGCAAACCCACAACTCT
CTGGCCTGGGTGAGAGACAAGGAAAAGGCTTATTTTGACTCCTGGTTCTGGTCCAAGGTCAAAG
GGCATCTGGGTATGGCCCTCTTGTTGCCAGAGTGCTCAGGTAGCATTGGCTAACACATTACAAA
ACATGAGAAGCGTTTGTTTGTCTTCAGAGTCTCTTGTAGCCCACATTGACCAAAGTTCATTCTG
TCTGAAATCGTCAGACACTTTCTGATTCTTTGGCCTCAGTCTCCTTAAAGCTGGGATTCAAATA
TATACCACTCACTTAGGAGGCAGAGGCCAGCCTGGTCACACAGCAAGTTCCATGCCAGCCAGCG

hide sequence

RefSeq Acc Id:

XM_039089011 ⟹ XP_038944939

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	32,260,108 - 32,295,866 (-)	NCBI
mRatBN7.2	12	26,623,968 - 26,659,749 (-)	NCBI

RefSeq Acc Id:

XM_063270985 ⟹ XP_063127055

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	32,260,108 - 32,315,116 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_446122	(Get FASTA)	NCBI Sequence Viewer
	XP_038944939	(Get FASTA)	NCBI Sequence Viewer
	XP_063127055	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD16878	(Get FASTA)	NCBI Sequence Viewer
	AAH59117	(Get FASTA)	NCBI Sequence Viewer
	AAL57492	(Get FASTA)	NCBI Sequence Viewer
	EDM13470	(Get FASTA)	NCBI Sequence Viewer
	EDM13471	(Get FASTA)	NCBI Sequence Viewer
	EDM13472	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000084882.1
	ENSRNOP00000098382
	ENSRNOP00000101135
GenBank Protein	Q8VHM6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446122 ⟸ NM_053670
- UniProtKB:	Q9Z0W9 (UniProtKB/Swiss-Prot), Q8VHM6 (UniProtKB/Swiss-Prot), A6J0N3 (UniProtKB/TrEMBL), A0A8I5XVS4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEVKDANAALLSNYEVFQLLTDLKEQRKESGKNKHSAGQQNLNAITYETLKYISKTPCKNQSPA IVQEFLTAMKSHKLTKAEKLQLLNHRPMTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAGP EDEQSKSTSNDAAMEEEEPA hide sequence

Ensembl Acc Id:

ENSRNOP00000073151 ⟸ ENSRNOT00000079176

Ensembl Acc Id:

ENSRNOP00000001202 ⟸ ENSRNOT00000001202

RefSeq Acc Id:	XP_038944939 ⟸ XM_039089011
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000095977 ⟸ ENSRNOT00000104408

Ensembl Acc Id:

ENSRNOP00000070920 ⟸ ENSRNOT00000079546

Ensembl Acc Id:

ENSRNOP00000077096 ⟸ ENSRNOT00000119276

Ensembl Acc Id:

ENSRNOP00000083764 ⟸ ENSRNOT00000109091

Ensembl Acc Id:

ENSRNOP00000078246 ⟸ ENSRNOT00000112952

Ensembl Acc Id:

ENSRNOP00000084882 ⟸ ENSRNOT00000107624

RefSeq Acc Id:	XP_063127055 ⟸ XM_063270985
- Peptide Label:	isoform X1
- UniProtKB:	F8WFG9 (UniProtKB/TrEMBL), A0A8I5XVS4 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000098382 ⟸ ENSRNOT00000120757

Ensembl Acc Id:

ENSRNOP00000101135 ⟸ ENSRNOT00000136822

Ensembl Acc Id:

ENSRNOP00000098383 ⟸ ENSRNOT00000120758

Ensembl Acc Id:

ENSRNOP00000106353 ⟸ ENSRNOT00000157265

Protein Domains

RNA polymerase Rpb4/RPC9 core

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8VHM6-F1-model_v2	AlphaFold	Q8VHM6	1-148	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620753	AgrOrtholog
BioCyc Gene	G2FUF-19523	BioCyc
Ensembl Genes	ENSRNOG00000000901	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000071267	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000107624.1	UniProtKB/Swiss-Prot
	ENSRNOT00000120757	ENTREZGENE
	ENSRNOT00000136822	ENTREZGENE
Gene3D-CATH	1.20.1250.40	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6891094	IMAGE-MGC_LOAD
InterPro	HRDC-like_sf	UniProtKB/Swiss-Prot
	RNA_pol_Rpb4/RPC9_core	UniProtKB/Swiss-Prot
	RPB4/RPC9	UniProtKB/Swiss-Prot
	Rpb4/RPC9_sf	UniProtKB/Swiss-Prot
	RPC9	UniProtKB/Swiss-Prot
KEGG Report	rno:114205	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72700	IMAGE-MGC_LOAD
NCBI Gene	114205	ENTREZGENE
PANTHER	DNA-DIRECTED RNA POLYMERASE III SUBUNIT RPC9	UniProtKB/Swiss-Prot
	PTHR15561	UniProtKB/Swiss-Prot
Pfam	RNA_pol_Rpb4	UniProtKB/Swiss-Prot
PhenoGen	Crcp	PhenoGen
RatGTEx	ENSRNOG00000000901	RatGTEx
	ENSRNOG00000071267	RatGTEx
SMART	RPOL4c	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47819	UniProtKB/Swiss-Prot
UniProt	A0A8I5XVS4	ENTREZGENE
	A0ABK0L802_RAT	UniProtKB/TrEMBL
	A0ABK0L8Q6_RAT	UniProtKB/TrEMBL
	A0ABK0LCU6_RAT	UniProtKB/TrEMBL
	A6J0N2_RAT	UniProtKB/TrEMBL
	A6J0N3	ENTREZGENE, UniProtKB/TrEMBL
	F8WFG9	ENTREZGENE
	Q8VHM6	ENTREZGENE
	Q9Z0W9	ENTREZGENE
	RPC9_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q9Z0W9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2010-02-04	Crcp	CGRP receptor component	Crcp	calcitonin gene-related peptide-receptor component	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-11-05	Crcp	calcitonin gene-related peptide-receptor component	Crcp	calcitonin gene-related peptide-receptor component protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Crcp	calcitonin gene-related peptide-receptor component protein			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Crcp	calcitonin gene-related peptide-receptor component protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	reduced protein levels are detected in the hippocampus and occipital cortex of rats exposed to maternal deprivation and other early life stress	727373

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations