Symbol:
Kl
Name:
Klotho
RGD ID:
620396
Description:
Predicted to enable fibroblast growth factor binding activity and fibroblast growth factor receptor binding activity. Involved in several processes, including norepinephrine biosynthetic process; response to angiotensin; and response to vitamin D. Predicted to be located in apical plasma membrane and extracellular region. Used to study familial hyperlipidemia; hypertension; and kidney failure. Biomarker of chronic kidney disease (multiple); hypertension; retinitis pigmentosa; secondary hyperparathyroidism; and type 2 diabetes mellitus. Human ortholog(s) of this gene implicated in coronary artery disease; intracranial embolism; and spondylosis. Orthologous to human KL (klotho); PARTICIPATES IN fibroblast growth factor signaling pathway; pentose and glucuronate interconversion pathway; starch and sucrose metabolic pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KL (klotho) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Kl (klotho) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kl (klotho) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KL (klotho) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KL (klotho) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kl (klotho) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KL (klotho) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KL (klotho) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kl (klotho) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
KL (klotho)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kl (klotho)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kl (klotho)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG9701
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
klo-1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
klo-2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
kl
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 5,326,003 - 5,367,016 (+) NCBI GRCr8 mRatBN7.2 12 490,402 - 531,417 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 490,399 - 530,080 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 1,064,277 - 1,103,820 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 1,586,514 - 1,626,063 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 486,601 - 526,810 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 942,974 - 987,206 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 943,006 - 987,551 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 929,158 - 972,144 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 3,732,712 - 3,772,371 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 3,732,711 - 3,772,371 (-) NCBI Celera 12 2,195,730 - 2,234,485 (+) NCBI Celera Cytogenetic Map 12 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kl Rat (-)-epigallocatechin 3-gallate decreases expression ISO KL (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of KL mRNA CTD PMID:20706672 Kl Rat (Z)-ligustilide increases expression ISO Kl (Mus musculus) 6480464 ligustilide results in increased expression of KL mRNA and ligustilide results in increased expression of KL protein CTD PMID:23973442 Kl Rat (Z)-ligustilide increases expression ISO KL (Homo sapiens) 6480464 ligustilide results in increased expression of KL mRNA and ligustilide results in increased expression of KL protein CTD PMID:23973442 Kl Rat 1,1-dichloroethene decreases expression ISO Kl (Mus musculus) 6480464 vinylidene chloride results in decreased expression of KL mRNA CTD PMID:26682919 Kl Rat 1-[(2,3,4-trimethoxyphenyl)methyl]piperazine multiple interactions ISO Kl (Mus musculus) 6480464 Trimetazidine inhibits the reaction [Paclitaxel results in decreased expression of KL protein] CTD PMID:36898573 Kl Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of KL mRNA CTD PMID:29097150 Kl Rat 17beta-estradiol 3-glucosiduronic acid multiple interactions ISO Kl (Mus musculus) 6480464 estradiol-3-glucuronide inhibits the reaction [KL protein results in increased hydrolysis of Glucuronides] CTD PMID:14701853 Kl Rat 17beta-estradiol 3-glucosiduronic acid increases hydrolysis ISO Kl (Mus musculus) 6480464 KL protein results in increased hydrolysis of estradiol-3-glucuronide CTD PMID:14701853 Kl Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO KL (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of KL mRNA CTD PMID:29581250 Kl Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Kl (Mus musculus) 6480464 KL protein inhibits the reaction [Tetrachlorodibenzodioxin promotes the reaction [lipopolysaccharide more ... CTD PMID:29885354 Kl Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Kl (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KL mRNA CTD PMID:33956508 Kl Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KL mRNA CTD PMID:32109520 Kl Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions ISO Kl (Mus musculus) 6480464 KL protein inhibits the reaction [Trinitrobenzenesulfonic Acid results in decreased expression of TRPV5 protein] CTD PMID:23747339 Kl Rat 2,4,6-trinitrobenzenesulfonic acid decreases expression ISO Kl (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in decreased expression of KL protein CTD PMID:23747339 Kl Rat 2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid multiple interactions ISO Kl (Mus musculus) 6480464 anacardic acid inhibits the reaction [Dronabinol results in increased expression of KL mRNA] CTD PMID:28481360 Kl Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO KL (Homo sapiens) 6480464 [3 more ... CTD PMID:31820026 Kl Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Kl (Mus musculus) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of KL mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of KL protein CTD PMID:31009676 Kl Rat 4-hydroperoxycyclophosphamide decreases expression ISO Kl (Mus musculus) 6480464 perfosfamide results in decreased expression of KL mRNA CTD PMID:19429390 Kl Rat 6-propyl-2-thiouracil multiple interactions ISO Kl (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of KL mRNA CTD PMID:36706583 Kl Rat acrylamide decreases expression ISO Kl (Mus musculus) 6480464 Acrylamide results in decreased expression of KL mRNA CTD PMID:35032568 Kl Rat amino acid multiple interactions ISO Kl (Mus musculus) 6480464 Amino Acids inhibits the reaction [KL gene mutant form results in decreased expression of BCL2 protein] more ... CTD PMID:25309793 Kl Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KL mRNA CTD PMID:16483693 Kl Rat androsterone 3-glucosiduronic acid multiple interactions ISO Kl (Mus musculus) 6480464 androsterone glucuronide inhibits the reaction [KL protein results in increased hydrolysis of Glucuronides] CTD PMID:14701853 Kl Rat arsenite(3-) decreases expression ISO Kl (Mus musculus) 6480464 arsenite results in decreased expression of KL mRNA CTD PMID:33053406 Kl Rat arsenous acid increases expression ISO KL (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of KL mRNA CTD PMID:27829220 Kl Rat benzo[a]pyrene increases expression ISO KL (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of KL mRNA CTD PMID:19152381 Kl Rat benzo[a]pyrene increases methylation ISO KL (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KL exon and Benzo(a)pyrene results in increased methylation of KL promoter CTD PMID:27901495 Kl Rat benzo[a]pyrene increases expression ISO Kl (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KL mRNA CTD PMID:27195522 Kl Rat benzo[a]pyrene multiple interactions ISO KL (Homo sapiens) 6480464 chlorophyllin inhibits the reaction [Benzo(a)pyrene results in increased expression of KL mRNA] CTD PMID:19152381 Kl Rat bilirubin IXalpha decreases expression EXP 6480464 Bilirubin results in decreased expression of KL mRNA and Bilirubin results in decreased expression of KL protein CTD PMID:28805483 Kl Rat bis(2-chloroethyl) sulfide decreases expression ISO Kl (Mus musculus) 6480464 Mustard Gas results in decreased expression of KL mRNA CTD PMID:15674843 Kl Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KL mRNA and bisphenol A results in decreased expression of KL protein CTD PMID:25181051 more ... Kl Rat bisphenol A increases expression ISO Kl (Mus musculus) 6480464 bisphenol A results in increased expression of KL mRNA CTD PMID:32926169 Kl Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KL mRNA CTD PMID:30816183 Kl Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of KL gene CTD PMID:28505145 Kl Rat bisphenol F decreases expression ISO Kl (Mus musculus) 6480464 bisphenol F results in decreased expression of KL mRNA CTD PMID:36706583 Kl Rat bleomycin A2 decreases expression ISO Kl (Mus musculus) 6480464 Bleomycin results in decreased expression of KL mRNA CTD PMID:29408570 Kl Rat cadmium atom affects methylation ISO KL (Homo sapiens) 6480464 Cadmium affects the methylation of KL gene CTD PMID:23665422 Kl Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of KL promoter CTD PMID:22457795 Kl Rat calciol multiple interactions ISO KL (Homo sapiens) 6480464 [3 more ... CTD PMID:31820026 Kl Rat calcium atom affects abundance ISO Kl (Mus musculus) 6480464 KL protein affects the abundance of Calcium CTD PMID:11796525 Kl Rat calcium atom multiple interactions ISO Kl (Mus musculus) 6480464 KL protein inhibits the reaction [[IFNG protein co-treated with TNF protein co-treated with IL1B protein] inhibits the reaction [TRPV5 protein results in increased uptake of Calcium]] CTD PMID:23747339 Kl Rat calcium(0) affects abundance ISO Kl (Mus musculus) 6480464 KL protein affects the abundance of Calcium CTD PMID:11796525 Kl Rat calcium(0) multiple interactions ISO Kl (Mus musculus) 6480464 KL protein inhibits the reaction [[IFNG protein co-treated with TNF protein co-treated with IL1B protein] inhibits the reaction [TRPV5 protein results in increased uptake of Calcium]] CTD PMID:23747339 Kl Rat chlorophyllin multiple interactions ISO KL (Homo sapiens) 6480464 chlorophyllin inhibits the reaction [Benzo(a)pyrene results in increased expression of KL mRNA] CTD PMID:19152381 Kl Rat cocaine increases expression ISO KL (Homo sapiens) 6480464 Cocaine results in increased expression of KL mRNA CTD PMID:15009677 Kl Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of KL protein CTD PMID:27523638 Kl Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of KL mRNA and Cuprizone results in increased expression of KL protein CTD PMID:26577399 Kl Rat cyclosporin A decreases expression ISO Kl (Mus musculus) 6480464 Cyclosporine results in decreased expression of KL protein CTD PMID:23765110 Kl Rat cyclosporin A decreases expression ISO KL (Homo sapiens) 6480464 Cyclosporine results in decreased expression of KL mRNA CTD PMID:27989131 Kl Rat cyclosporin A multiple interactions ISO Kl (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Cyclosporine results in decreased expression of KL protein] CTD PMID:23765110 Kl Rat dehydroepiandrosterone multiple interactions ISO Kl (Mus musculus) 6480464 Dehydroepiandrosterone analog inhibits the reaction [KL protein results in increased hydrolysis of Glucuronides] CTD PMID:14701853 Kl Rat dexamethasone multiple interactions ISO Kl (Mus musculus) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of KL mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of KL protein CTD PMID:31009676 Kl Rat diarsenic trioxide increases expression ISO KL (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of KL mRNA CTD PMID:27829220 Kl Rat diiodine multiple interactions ISO Kl (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of KL mRNA CTD PMID:36706583 Kl Rat dioxygen decreases expression ISO KL (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of KL protein CTD PMID:35123992 Kl Rat dioxygen multiple interactions ISO KL (Homo sapiens) 6480464 KL protein affects the reaction [Oxygen deficiency results in increased expression of ACTA2 protein] more ... CTD PMID:35123992 Kl Rat diquat decreases expression ISO Kl (Mus musculus) 6480464 Diquat results in decreased expression of KL protein CTD PMID:36851058 Kl Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of KL mRNA and Doxorubicin results in decreased expression of KL protein CTD PMID:20606417 Kl Rat doxorubicin multiple interactions EXP 6480464 EPO protein inhibits the reaction [Doxorubicin results in decreased expression of KL mRNA] and EPO protein inhibits the reaction [Doxorubicin results in decreased expression of KL protein] CTD PMID:20606417 Kl Rat elemental selenium multiple interactions ISO KL (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of KL mRNA CTD PMID:19244175 Kl Rat estriol 3-O-(beta-D-glucuronide) increases hydrolysis ISO Kl (Mus musculus) 6480464 KL protein results in increased hydrolysis of estriol 3-glucuronide CTD PMID:14701853 Kl Rat estriol 3-O-(beta-D-glucuronide) multiple interactions ISO Kl (Mus musculus) 6480464 estriol 3-glucuronide inhibits the reaction [KL protein results in increased hydrolysis of Glucuronides] CTD PMID:14701853 Kl Rat estrone 3-O-(beta-D-glucuronide) increases hydrolysis ISO Kl (Mus musculus) 6480464 KL protein results in increased hydrolysis of estrone-3-glucuronide CTD PMID:14701853 Kl Rat estrone 3-O-(beta-D-glucuronide) multiple interactions ISO Kl (Mus musculus) 6480464 estrone-3-glucuronide inhibits the reaction [KL protein results in increased hydrolysis of Glucuronides] CTD PMID:14701853 Kl Rat ethanol affects expression ISO Kl (Mus musculus) 6480464 Ethanol affects the expression of KL mRNA CTD PMID:30319688 Kl Rat folic acid decreases expression ISO Kl (Mus musculus) 6480464 Folic Acid results in decreased expression of KL mRNA CTD PMID:38272249 Kl Rat folic acid multiple interactions ISO Kl (Mus musculus) 6480464 icariin inhibits the reaction [Folic Acid results in decreased expression of KL mRNA] CTD PMID:38272249 Kl Rat fosinopril increases expression EXP 6480464 Fosinopril results in increased expression of KL mRNA and Fosinopril results in increased expression of KL protein CTD PMID:21051829 Kl Rat genistein decreases expression ISO KL (Homo sapiens) 6480464 Genistein results in decreased expression of KL mRNA CTD PMID:20706672 Kl Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of KL mRNA CTD PMID:24395379 Kl Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of KL mRNA CTD PMID:38314887 Kl Rat guggulsterone multiple interactions ISO KL (Homo sapiens) 6480464 KL protein affects the reaction [pregna-4 more ... CTD PMID:35123992 Kl Rat hypoxanthine multiple interactions ISO Kl (Mus musculus) 6480464 [Hypoxanthine co-treated with potassium oxonate] results in decreased expression of KL mRNA and salinomycin inhibits the reaction [[Hypoxanthine co-treated with potassium oxonate] results in decreased expression of KL mRNA] CTD PMID:39222901 Kl Rat icariin multiple interactions ISO Kl (Mus musculus) 6480464 icariin inhibits the reaction [Folic Acid results in decreased expression of KL mRNA] CTD PMID:38272249 Kl Rat indoxyl sulfate decreases expression EXP 6480464 Indican results in decreased expression of KL mRNA CTD PMID:21389697 Kl Rat indoxyl sulfate decreases expression ISO KL (Homo sapiens) 6480464 Indican results in decreased expression of KL mRNA and Indican results in decreased expression of KL protein CTD PMID:21389697 Kl Rat indoxyl sulfate multiple interactions ISO KL (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Indican results in decreased expression of KL mRNA] more ... CTD PMID:21389697 and PMID:33458837 Kl Rat lead diacetate affects expression EXP 6480464 lead acetate affects the expression of KL mRNA CTD PMID:21864555 Kl Rat lead diacetate multiple interactions ISO Kl (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of KL protein CTD PMID:39150886 Kl Rat lead diacetate decreases expression ISO Kl (Mus musculus) 6480464 lead acetate results in decreased expression of KL mRNA CTD PMID:22609695 Kl Rat lead(0) multiple interactions ISO Kl (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of KL protein CTD PMID:39150886 Kl Rat lipopolysaccharide increases expression ISO Kl (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of KL mRNA CTD PMID:12057914 Kl Rat lipopolysaccharide multiple interactions ISO KL (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of KL mRNA CTD PMID:35811015 Kl Rat malonaldehyde multiple interactions ISO Kl (Mus musculus) 6480464 Amino Acids inhibits the reaction [KL gene mutant form results in increased abundance of Malondialdehyde] and H 1356 inhibits the reaction [Amino Acids inhibits the reaction [KL gene mutant form results in increased abundance of Malondialdehyde]] CTD PMID:25309793 Kl Rat malonaldehyde increases abundance ISO Kl (Mus musculus) 6480464 KL gene mutant form results in increased abundance of Malondialdehyde CTD PMID:25309793 Kl Rat melatonin multiple interactions ISO Kl (Mus musculus) 6480464 4-phenyl-2-propionamidotetraline inhibits the reaction [Melatonin inhibits the reaction [KL mutant form affects the localization of and results in decreased activity of NFE2L2 protein]] more ... CTD PMID:25550330 Kl Rat mono(2-ethylhexyl) phthalate decreases expression ISO Kl (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of KL mRNA CTD PMID:22401849 Kl Rat N-acetyl-L-cysteine multiple interactions ISO Kl (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Cyclosporine results in decreased expression of KL protein] CTD PMID:23765110 Kl Rat N-acetyl-L-cysteine increases expression ISO KL (Homo sapiens) 6480464 Acetylcysteine results in increased expression of KL protein CTD PMID:21389697 Kl Rat N-acetyl-L-cysteine multiple interactions ISO KL (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Indican results in decreased expression of KL mRNA] and Acetylcysteine inhibits the reaction [Indican results in decreased expression of KL protein] CTD PMID:21389697 Kl Rat N-acetyl-L-cysteine increases expression EXP 6480464 Acetylcysteine results in increased expression of KL protein CTD PMID:23183129 Kl Rat nitrates decreases expression EXP 6480464 Nitrates results in decreased expression of KL mRNA CTD PMID:30022042 Kl Rat Osajin decreases expression ISO KL (Homo sapiens) 6480464 osajin results in decreased expression of KL mRNA CTD PMID:20706672 Kl Rat paclitaxel multiple interactions ISO Kl (Mus musculus) 6480464 Trimetazidine inhibits the reaction [Paclitaxel results in decreased expression of KL protein] CTD PMID:36898573 Kl Rat paclitaxel decreases expression ISO Kl (Mus musculus) 6480464 Paclitaxel results in decreased expression of KL protein CTD PMID:36898573 Kl Rat paraquat decreases response to substance ISO Kl (Mus musculus) 6480464 KL protein results in decreased susceptibility to Paraquat CTD PMID:16186101 Kl Rat phenobarbital decreases expression ISO KL (Homo sapiens) 6480464 Phenobarbital results in decreased expression of KL mRNA CTD PMID:19084549 Kl Rat phosphorus atom affects abundance ISO Kl (Mus musculus) 6480464 KL protein affects the abundance of Phosphorus CTD PMID:11796525 Kl Rat phosphorus(.) affects abundance ISO Kl (Mus musculus) 6480464 KL protein affects the abundance of Phosphorus CTD PMID:11796525 Kl Rat Pomiferin decreases expression ISO KL (Homo sapiens) 6480464 pomiferin results in decreased expression of KL mRNA CTD PMID:20706672 Kl Rat Potassium 2,6-dihydroxytriazinecarboxylate multiple interactions ISO Kl (Mus musculus) 6480464 [Hypoxanthine co-treated with potassium oxonate] results in decreased expression of KL mRNA and salinomycin inhibits the reaction [[Hypoxanthine co-treated with potassium oxonate] results in decreased expression of KL mRNA] CTD PMID:39222901 Kl Rat potassium dichromate increases expression ISO Kl (Mus musculus) 6480464 Potassium Dichromate results in increased expression of KL mRNA CTD PMID:23608068 Kl Rat propanal decreases expression ISO KL (Homo sapiens) 6480464 propionaldehyde results in decreased expression of KL mRNA CTD PMID:26079696 Kl Rat puerarin decreases expression ISO KL (Homo sapiens) 6480464 puerarin results in decreased expression of KL mRNA CTD PMID:20706672 Kl Rat pyrrolidine dithiocarbamate increases expression ISO KL (Homo sapiens) 6480464 pyrrolidine dithiocarbamic acid results in increased expression of KL protein CTD PMID:21389697 Kl Rat pyrrolidine dithiocarbamate multiple interactions ISO KL (Homo sapiens) 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [Indican results in decreased expression of KL mRNA] and pyrrolidine dithiocarbamic acid inhibits the reaction [Indican results in decreased expression of KL protein] CTD PMID:21389697 Kl Rat resveratrol decreases expression ISO KL (Homo sapiens) 6480464 resveratrol results in decreased expression of KL mRNA CTD PMID:20706672 Kl Rat resveratrol multiple interactions ISO KL (Homo sapiens) 6480464 ATF3 protein affects the reaction [resveratrol results in increased expression of KL mRNA] CTD PMID:24911970 Kl Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of KL mRNA and resveratrol results in increased expression of KL protein CTD PMID:24911970 Kl Rat resveratrol multiple interactions EXP 6480464 ATF3 protein affects the reaction [resveratrol results in increased expression of KL mRNA] more ... CTD PMID:24911970 Kl Rat resveratrol increases expression ISO Kl (Mus musculus) 6480464 resveratrol results in increased expression of KL mRNA and resveratrol results in increased expression of KL protein CTD PMID:24911970 Kl Rat resveratrol increases expression ISO KL (Homo sapiens) 6480464 Resveratrol results in increased expression of KL mRNA and Resveratrol results in increased expression of KL protein CTD PMID:24911970 Kl Rat retinyl acetate increases expression ISO Kl (Mus musculus) 6480464 retinol acetate results in increased expression of KL mRNA CTD PMID:16772331 Kl Rat Rosavin decreases expression ISO KL (Homo sapiens) 6480464 rosavin results in decreased expression of KL mRNA CTD PMID:20706672 Kl Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO KL (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of KL mRNA CTD PMID:35811015 Kl Rat Salinomycin multiple interactions ISO Kl (Mus musculus) 6480464 salinomycin inhibits the reaction [[Hypoxanthine co-treated with potassium oxonate] results in decreased expression of KL mRNA] CTD PMID:39222901 Kl Rat selenium atom multiple interactions ISO KL (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of KL mRNA CTD PMID:19244175 Kl Rat SL-327 multiple interactions ISO Kl (Mus musculus) 6480464 SL 327 inhibits the reaction [Melatonin inhibits the reaction [KL mutant form affects the localization of and results in decreased activity of NFE2L2 protein]] more ... CTD PMID:25550330 Kl Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of KL mRNA CTD PMID:32736004 Kl Rat sodium arsenite decreases expression ISO Kl (Mus musculus) 6480464 sodium arsenite results in decreased expression of KL mRNA CTD PMID:36209798 Kl Rat sodium arsenite multiple interactions EXP 6480464 sodium arsenite results in decreased expression of and results in decreased secretion of KL protein CTD PMID:32736004 Kl Rat sodium chlorate decreases expression ISO KL (Homo sapiens) 6480464 sodium chlorate results in decreased expression of KL protein CTD PMID:27432882 Kl Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of KL CTD PMID:24136780 Kl Rat streptozocin multiple interactions EXP 6480464 rosiglitazone inhibits the reaction [Streptozocin results in decreased expression of KL] CTD PMID:24136780 Kl Rat taurocholic acid multiple interactions ISO Kl (Mus musculus) 6480464 Taurocholic Acid inhibits the reaction [KL protein results in increased hydrolysis of Glucuronides] CTD PMID:14701853 Kl Rat testosterone 17-glucosiduronic acid multiple interactions ISO Kl (Mus musculus) 6480464 testosterone glucuronate inhibits the reaction [KL protein results in increased hydrolysis of Glucuronides] CTD PMID:14701853 Kl Rat titanium dioxide decreases methylation ISO Kl (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KL gene CTD PMID:35295148 Kl Rat triptonide increases expression ISO Kl (Mus musculus) 6480464 triptonide results in increased expression of KL mRNA CTD PMID:33045310 Kl Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of KL mRNA CTD PMID:11768731 Kl Rat valproic acid decreases methylation ISO KL (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of KL gene CTD PMID:29154799 Kl Rat valsartan increases expression EXP 6480464 Valsartan results in increased expression of KL mRNA and Valsartan results in increased expression of KL protein CTD PMID:21051829 Kl Rat vancomycin increases expression ISO Kl (Mus musculus) 6480464 Vancomycin results in increased expression of KL mRNA CTD PMID:18930951 Kl Rat vitamin D multiple interactions ISO KL (Homo sapiens) 6480464 KL protein affects the reaction [FGF23 protein affects the abundance of Vitamin D] CTD PMID:17710231 Kl Rat vitamin E multiple interactions ISO KL (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of KL mRNA CTD PMID:19244175 Kl Rat zinc atom decreases expression ISO KL (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of KL mRNA CTD PMID:18356318 Kl Rat zinc(0) decreases expression ISO KL (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of KL mRNA CTD PMID:18356318
Imported Annotations - KEGG (archival)
Alzheimer's disease (ISO) amenorrhea (ISO) Animal Disease Models (ISO) arteriosclerosis (ISO) atherosclerosis (ISO) calcinosis (ISO) Cardiomegaly (ISO) chronic kidney disease (IEP,ISO) coronary artery disease (ISO) Diabetic Nephropathies (IEP) Emphysema (ISO) end stage renal disease (IEP,ISO) Experimental Colitis (ISO) familial hyperlipidemia (IDA) gonadal disease (ISO) hypercalcemia (ISO) Hypercalcemia, Infantile, 1 (ISO) Hypercalciuria, Childhood Idiopathic (ISO) hyperphosphatemia (ISO) hyperphosphatemic familial tumoral calcinosis (ISO,ISS) Hyperphosphatemic Familial Tumoral Calcinosis 1 (ISO) Hyperphosphatemic Familial Tumoral Calcinosis 3 (ISO) hypertension (IDA,IEP,ISO) infertility (ISO) intracranial embolism (ISO) kidney disease (ISO) kidney failure (IDA) Kidney Reperfusion Injury (IEP,ISO) Knee Osteoarthritis (ISO) learning disability (ISO) Memory Disorders (ISO) Metabolic Syndrome (IEP,ISO) osteoporosis (ISO) Premature Aging (ISO) pulmonary emphysema (ISS) retinitis pigmentosa (IEP,ISO) secondary hyperparathyroidism (IEP) sensorineural hearing loss (ISO) Septic Peritonitis (ISO) Sinoatrial Block (ISO) skin disease (ISO) spondylosis (ISO) Stroke (ISO) type 2 diabetes mellitus (IEP,ISO) Vascular Calcification (ISO)
(-)-epigallocatechin 3-gallate (ISO) (Z)-ligustilide (ISO) 1,1-dichloroethene (ISO) 1-[(2,3,4-trimethoxyphenyl)methyl]piperazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol 3-glucosiduronic acid (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4-hydroperoxycyclophosphamide (ISO) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) amino acid (ISO) ammonium chloride (EXP) androsterone 3-glucosiduronic acid (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bilirubin IXalpha (EXP) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (ISO) cadmium atom (ISO) cadmium dichloride (EXP) calciol (ISO) calcium atom (ISO) calcium(0) (ISO) chlorophyllin (ISO) cocaine (ISO) Cuprizon (EXP) cyclosporin A (ISO) dehydroepiandrosterone (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diiodine (ISO) dioxygen (ISO) diquat (ISO) doxorubicin (EXP) elemental selenium (ISO) estriol 3-O-(beta-D-glucuronide) (ISO) estrone 3-O-(beta-D-glucuronide) (ISO) ethanol (ISO) folic acid (ISO) fosinopril (EXP) genistein (ISO) glycidol (EXP) glyphosate (EXP) guggulsterone (ISO) hypoxanthine (ISO) icariin (ISO) indoxyl sulfate (EXP,ISO) lead diacetate (EXP,ISO) lead(0) (ISO) lipopolysaccharide (ISO) malonaldehyde (ISO) melatonin (ISO) mono(2-ethylhexyl) phthalate (ISO) N-acetyl-L-cysteine (EXP,ISO) nitrates (EXP) Osajin (ISO) paclitaxel (ISO) paraquat (ISO) phenobarbital (ISO) phosphorus atom (ISO) phosphorus(.) (ISO) Pomiferin (ISO) Potassium 2,6-dihydroxytriazinecarboxylate (ISO) potassium dichromate (ISO) propanal (ISO) puerarin (ISO) pyrrolidine dithiocarbamate (ISO) resveratrol (EXP,ISO) retinyl acetate (ISO) Rosavin (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) Salinomycin (ISO) selenium atom (ISO) SL-327 (ISO) sodium arsenite (EXP,ISO) sodium chlorate (ISO) streptozocin (EXP) taurocholic acid (ISO) testosterone 17-glucosiduronic acid (ISO) titanium dioxide (ISO) triptonide (ISO) troglitazone (EXP) valproic acid (ISO) valsartan (EXP) vancomycin (ISO) vitamin D (ISO) vitamin E (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Downregulation of the Klotho gene in the kidney under sustained circulatory stress in rats.
Aizawa H, etal., Biochem Biophys Res Commun. 1998 Aug 28;249(3):865-71.
2.
Association between a functional variant of the KLOTHO gene and high-density lipoprotein cholesterol, blood pressure, stroke, and longevity.
Arking DE, etal., Circ Res. 2005 Mar 4;96(4):412-8. Epub 2005 Jan 27.
3.
The parathyroid is a target organ for FGF23 in rats.
Ben-Dov IZ, etal., J Clin Invest. 2007 Dec;117(12):4003-8.
4.
Vitamin D-deficient diet rescues hearing loss in Klotho mice.
Carpinelli MR, etal., Hear Res. 2011 May;275(1-2):105-9. doi: 10.1016/j.heares.2010.12.009. Epub 2010 Dec 16.
5.
Fosinopril and valsartan intervention in gene expression of Klotho, MMP-9, TIMP-1, and PAI-1 in the kidney of spontaneously hypertensive rats.
Cheng X, etal., Zhong Nan Da Xue Xue Bao Yi Xue Ban. 2010 Oct;35(10):1048-56. doi: 10.3969/j.issn.1672-7347.2010.10.004.
6.
Retinitis Pigmentosa: over-expression of anti-ageing protein Klotho in degenerating photoreceptors.
Farinelli P, etal., J Neurochem. 2013 Dec;127(6):868-79. doi: 10.1111/jnc.12353. Epub 2013 Jul 22.
7.
Modulating fibroblast growth factor 21 in hyperphagic OLETF rats with daily exercise and caloric restriction.
Fletcher JA, etal., Appl Physiol Nutr Metab. 2012 Dec;37(6):1054-62. doi: 10.1139/h2012-091. Epub 2012 Aug 15.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
Increased parathyroid expression of klotho in uremic rats.
Hofman-Bang J, etal., Kidney Int. 2010 Dec;78(11):1119-27. doi: 10.1038/ki.2010.215. Epub 2010 Jul 14.
11.
Klotho deficiency causes vascular calcification in chronic kidney disease.
Hu MC, etal., J Am Soc Nephrol. 2011 Jan;22(1):124-36. doi: 10.1681/ASN.2009121311. Epub 2010 Nov 29.
12.
Rosiglitazone is effective to improve renal damage in type-1-like diabetic rats.
Huang KC, etal., Horm Metab Res. 2014 Apr;46(4):240-4. doi: 10.1055/s-0033-1357161. Epub 2013 Oct 17.
13.
Klotho gene polymorphism may be a genetic risk factor for atherosclerotic coronary artery disease but not for vasospastic angina in Japanese.
Imamura A, etal., Clin Chim Acta. 2006 Sep;371(1-2):66-70. Epub 2006 Mar 6.
14.
Sepsis-induced hypercytokinemia and lymphocyte apoptosis in aging-accelerated Klotho knockout mice.
Inoue S, etal., Shock. 2013 Mar;39(3):311-6. doi: 10.1097/SHK.0b013e3182845445.
15.
Klotho is a genetic risk factor for ischemic stroke caused by cardioembolism in Korean females.
Kim Y, etal., Neurosci Lett. 2006 Oct 30;407(3):189-94. Epub 2006 Sep 14.
16.
Severely reduced production of klotho in human chronic renal failure kidney.
Koh N, etal., Biochem Biophys Res Commun. 2001 Feb 2;280(4):1015-20.
17.
Klotho upregulation contributes to the neuroprotection of ligustilide in an Alzheimer's disease mouse model.
Kuang X, etal., Neurobiol Aging. 2014 Jan;35(1):169-78. doi: 10.1016/j.neurobiolaging.2013.07.019. Epub 2013 Aug 21.
18.
Mutation of the mouse klotho gene leads to a syndrome resembling ageing.
Kuro-o M, etal., Nature. 1997 Nov 6;390(6655):45-51.
19.
Regulation of fibroblast growth factor-23 signaling by klotho.
Kurosu H, etal., J Biol Chem. 2006 Mar 10;281(10):6120-3. Epub 2006 Jan 25.
20.
[Klotho gene attenuates the progression of hypertension and heart damage in spontaneous hypertensive rats].
Li BS, etal., Zhonghua Yi Xue Yi Chuan Xue Za Zhi. 2012 Dec;29(6):662-8. doi: 10.3760/cma.j.issn.1003-9406.2012.06.008.
21.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
22.
In vivo klotho gene transfer ameliorates angiotensin II-induced renal damage.
Mitani H, etal., Hypertension 2002 Apr;39(4):838-43.
23.
Endothelial dysfunction in the klotho mouse and downregulation of klotho gene expression in various animal models of vascular and metabolic diseases.
Nagai R, etal., Cell Mol Life Sci. 2000 May;57(5):738-46.
24.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
25.
Association of klotho gene polymorphism with bone density and spondylosis of the lumbar spine in postmenopausal women.
Ogata N, etal., Bone. 2002 Jul;31(1):37-42.
26.
Molecular cloning of rat klotho cDNA: markedly decreased expression of klotho by acute inflammatory stress.
Ohyama Y, etal., Biochem Biophys Res Commun 1998 Oct 29;251(3):920-5.
27.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
28.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
29.
GOA pipeline
RGD automated data pipeline
30.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
31.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
32.
The differential effects of age on the association of KLOTHO gene polymorphisms with coronary artery disease.
Rhee EJ, etal., Metabolism. 2006 Oct;55(10):1344-51.
33.
In vivo klotho gene delivery protects against endothelial dysfunction in multiple risk factor syndrome.
Saito Y, etal., Biochem Biophys Res Commun. 2000 Sep 24;276(2):767-72.
34.
N-acetylcysteine attenuates renal alterations induced by senescence in the rat.
Shimizu MH, etal., Exp Gerontol. 2013 Feb;48(2):298-303. doi: 10.1016/j.exger.2012.11.006. Epub 2012 Nov 23.
35.
Klotho reduces apoptosis in experimental ischaemic acute renal failure.
Sugiura H, etal., Nephrol Dial Transplant. 2005 Dec;20(12):2636-45. Epub 2005 Oct 4.
36.
Sinoatrial node dysfunction and early unexpected death of mice with a defect of klotho gene expression.
Takeshita K, etal., Circulation. 2004 Apr 13;109(14):1776-82. Epub 2004 Mar 22.
37.
Tumor necrosis factor and interferon-gamma down-regulate Klotho in mice with colitis.
Thurston RD, etal., Gastroenterology. 2010 Apr;138(4):1384-94, 1394.e1-2. doi: 10.1053/j.gastro.2009.12.002. Epub 2009 Dec 11.
38.
Association of KLOTHO gene polymorphisms with knee osteoarthritis in Greek population.
Tsezou A, etal., J Orthop Res. 2008 Nov;26(11):1466-70. doi: 10.1002/jor.20634.
39.
RNAi silencing of brain klotho potentiates cold-induced elevation of blood pressure via the endothelin pathway.
Wang X and Sun Z, Physiol Genomics. 2010 Apr 1;41(2):120-6. doi: 10.1152/physiolgenomics.00192.2009. Epub 2010 Jan 19.
40.
Renal expression of FGF23 in progressive renal disease of diabetes and the effect of ACE inhibitor.
Zanchi C, etal., PLoS One. 2013 Aug 14;8(8):e70775. doi: 10.1371/journal.pone.0070775. eCollection 2013.
Kl Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 5,326,003 - 5,367,016 (+) NCBI GRCr8 mRatBN7.2 12 490,402 - 531,417 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 490,399 - 530,080 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 1,064,277 - 1,103,820 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 1,586,514 - 1,626,063 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 486,601 - 526,810 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 942,974 - 987,206 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 943,006 - 987,551 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 929,158 - 972,144 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 3,732,712 - 3,772,371 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 3,732,711 - 3,772,371 (-) NCBI Celera 12 2,195,730 - 2,234,485 (+) NCBI Celera Cytogenetic Map 12 p12 NCBI
KL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 33,016,243 - 33,066,143 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 33,016,423 - 33,066,143 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 33,590,561 - 33,640,280 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 32,488,571 - 32,538,279 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 32,488,570 - 32,538,279 NCBI Celera 13 14,657,386 - 14,707,106 (+) NCBI Celera Cytogenetic Map 13 q13.1 NCBI HuRef 13 14,401,659 - 14,452,070 (+) NCBI HuRef CHM1_1 13 33,558,119 - 33,607,832 (+) NCBI CHM1_1 T2T-CHM13v2.0 13 32,233,557 - 32,283,464 (+) NCBI T2T-CHM13v2.0
Kl Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 150,876,072 - 150,917,282 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 150,876,072 - 150,917,282 (+) Ensembl GRCm39 Ensembl GRCm38 5 150,952,607 - 150,993,817 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 150,952,607 - 150,993,817 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 151,755,182 - 151,796,392 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 151,221,078 - 151,262,196 (+) NCBI MGSCv36 mm8 Celera 5 148,957,067 - 148,998,277 (+) NCBI Celera Cytogenetic Map 5 G3 NCBI cM Map 5 89.77 NCBI
Kl Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955431 12,782,846 - 12,833,215 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955431 12,782,913 - 12,833,215 (-) NCBI ChiLan1.0 ChiLan1.0
KL Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 32,579,481 - 32,629,284 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 23,685,802 - 23,735,607 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 14,272,463 - 14,321,122 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 32,697,381 - 32,752,578 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 32,702,336 - 32,751,458 (+) Ensembl panpan1.1 panPan2
KL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 7,154,359 - 7,201,744 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 7,156,620 - 7,199,558 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 7,190,325 - 7,236,623 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 7,256,203 - 7,302,574 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 7,255,966 - 7,302,141 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 7,155,694 - 7,201,964 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 7,148,224 - 7,195,654 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 7,211,791 - 7,258,193 (-) NCBI UU_Cfam_GSD_1.0
Kl Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 168,294,810 - 168,347,489 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936472 27,604,517 - 27,650,086 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936472 27,604,681 - 27,649,613 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 9,427,037 - 9,479,228 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 9,427,236 - 9,479,251 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 9,357,470 - 9,390,509 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KL Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 11,755,015 - 11,799,537 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 11,755,016 - 11,797,596 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666057 32,549,747 - 32,594,290 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kl
.
Predicted Target Of
Count of predictions: 209 Count of miRNA genes: 146 Interacting mature miRNAs: 158 Transcripts: ENSRNOT00000001449 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1300174 Bw15 Body weight QTL 15 2.93 body mass (VT:0001259) body weight loss (CMO:0001399) 12 1 9318387 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
11
44
103
62
61
30
24
30
6
182
91
83
45
58
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001449 ⟹ ENSRNOP00000001449
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 490,399 - 530,080 (+) Ensembl Rnor_6.0 Ensembl 12 943,006 - 987,551 (+) Ensembl
RefSeq Acc Id:
NM_031336 ⟹ NP_112626
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 5,326,003 - 5,365,679 (+) NCBI mRatBN7.2 12 490,402 - 530,080 (+) NCBI Rnor_6.0 12 942,974 - 987,206 (+) NCBI Rnor_5.0 12 929,158 - 972,144 (+) NCBI RGSC_v3.4 12 3,732,712 - 3,772,371 (-) RGD Celera 12 2,195,730 - 2,234,485 (+) RGD
Sequence:
CCTCCCGGCTCCCGCAGCATGCCAGCCCGCGCCCCTCCTCGCCGCCTGCCGCGGCTCTTGCTGCTCCGTTTGCTGTCGCTGCATCTGCTGTTGCTCACCCTGCGCGCCCGCTGCCTAAGCGCTGAGCC
hide sequence
RefSeq Acc Id:
XM_039089809 ⟹ XP_038945737
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 5,344,261 - 5,367,016 (+) NCBI mRatBN7.2 12 510,542 - 531,417 (+) NCBI
RefSeq Acc Id:
NP_112626 ⟸ NM_031336
- Peptide Label:
precursor
- UniProtKB:
Q9Z2Y9 (UniProtKB/Swiss-Prot), A6KSV6 (UniProtKB/TrEMBL), A0A0H2UH96 (UniProtKB/TrEMBL)
- Sequence:
MPARAPPRRLPRLLLLRLLSLHLLLLTLRARCLSAEPGQGAQTWARFARPPVPEASGLLHDTFPDGFLWAVGSAAYQTEGGWRQHGKGASIWDTFTHHPRAIPEDSPIVMAPSGAPLPPLPSTGDVAS
hide sequence
Ensembl Acc Id:
ENSRNOP00000001449 ⟸ ENSRNOT00000001449
RefSeq Acc Id:
XP_038945737 ⟸ XM_039089809
- Peptide Label:
isoform X1
RGD ID: 13698360 Promoter ID: EPDNEW_R8885 Type: multiple initiation site Name: Kl_1 Description: Klotho SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 942,995 - 943,055 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Kl
Klotho
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Kl
Klotho
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_disease
upregulated in arteriosclerosis, osteoporosis, infertility, pulmonary emphysema
70544
gene_expression
expressed in kidney
70544
gene_process
has a role in protection against Ang II-induced renal damage
70544
gene_regulation
downregulated by Ang II
70544
gene_regulation
expression decreased by lipopolysaccharide
633145
