Symbol:
Polg
Name:
DNA polymerase gamma, catalytic subunit
RGD ID:
620057
Description:
Enables DNA-directed DNA polymerase activity. Involved in several processes, including cellular response to glucose stimulus; response to gamma radiation; and response to hyperoxia. Located in terminal bouton. Part of gamma DNA polymerase complex. Used to study Alpers-Huttenlocher syndrome and hepatocellular carcinoma. Biomarker of status epilepticus. Human ortholog(s) of this gene implicated in several diseases, including mitochondrial DNA depletion syndrome (multiple); mitochondrial myopathy (multiple); neurodegenerative disease (multiple); ovarian disease (multiple); and sensory ataxic neuropathy, dysarthria, and ophthalmoparesis. Orthologous to human POLG (DNA polymerase gamma, catalytic subunit); INTERACTS WITH (+)-pilocarpine; 17beta-estradiol; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
3'-5' exodeoxyribonuclease; 5'-deoxyribose-phosphate lyase; DNA polymerase gamma; DNA polymerase subunit gamma-1; DNA-directed DNA polymerase gamma; mitochondrial DNA polymerase catalytic subunit; polG-alpha; polymerase (DNA directed), gamma; polymerase (DNA) gamma, catalytic subunit
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
POLG (DNA polymerase gamma, catalytic subunit) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB
Mus musculus (house mouse):
Polg (polymerase (DNA directed), gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Polg (DNA polymerase gamma, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
POLG (DNA polymerase gamma, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
POLG (DNA polymerase gamma, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Polg (DNA polymerase gamma, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
POLG (DNA polymerase gamma, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
POLG (DNA polymerase gamma, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Polg (DNA polymerase gamma, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
POLG (DNA polymerase gamma, catalytic subunit)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Polg (polymerase (DNA directed), gamma)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
polg (polymerase (DNA directed), gamma)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MIP1
Alliance
DIOPT (OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
polg-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
tam
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
polg
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 142,792,119 - 142,808,933 (-) NCBI GRCr8 mRatBN7.2 1 133,382,764 - 133,399,578 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 133,382,766 - 133,398,567 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 141,292,744 - 141,307,834 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 148,462,157 - 148,477,247 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 141,379,870 - 141,394,960 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 141,172,117 - 141,188,893 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 141,172,531 - 141,188,031 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 142,133,892 - 142,150,597 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 135,197,075 - 135,212,178 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 135,275,417 - 135,290,521 (-) NCBI Celera 1 125,446,563 - 125,461,666 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:26224072 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11301032 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11301032 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:26467025 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:26968897 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:26557169 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:27111573 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11301032 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11301032 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:27538604 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:26169155 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11301032 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11301032 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11301032 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:26557169 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11301032 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:26554610 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:26467025 more ... Polg Rat Alpers-Huttenlocher syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11301032 more ... Polg Rat autistic disorder ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Autism ClinVar PMID:18156159 more ... Polg Rat autistic disorder ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Autism ClinVar PMID:18156159 more ... Polg Rat autosomal dominant intellectual developmental disorder ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Autosomal dominant non-syndromic intellectual disability ClinVar PMID:14745080 more ... Polg Rat autosomal dominant progressive external ophthalmoplegia 1 ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:29272804 more ... Polg Rat autosomal dominant progressive external ophthalmoplegia 1 ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat autosomal recessive progressive external ophthalmoplegia 1 ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat autosomal recessive progressive external ophthalmoplegia 1 ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:30373890 more ... Polg Rat benign neonatal seizures ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: neonatal seizures ClinVar PMID:14635118 more ... Polg Rat Bloom syndrome ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Bloom syndrome ClinVar PMID:17407155 and PMID:28492532 Polg Rat Camptocormia ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Bent Spine Syndrome ClinVar PMID:16621917 more ... Polg Rat CEREBELLAR ATAXIA INFANTILE WITH PROGRESSIVE EXTERNAL OPHTHALMOPLEGIA ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Cerebellar ataxia infantile with progressive external ophthalmoplegia ClinVar PMID:11431686 more ... Polg Rat CEREBELLAR ATAXIA INFANTILE WITH PROGRESSIVE EXTERNAL OPHTHALMOPLEGIA ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Cerebellar ataxia infantile with progressive external ophthalmoplegia ClinVar PMID:30404819 more ... Polg Rat Charcot-Marie-Tooth disease axonal type 2U ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: CHARCOT-MARIE-TOOTH DISEASE more ... ClinVar PMID:14557557 more ... Polg Rat Childhood Myocerebrohepatopathy Spectrum ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Childhood myocerebrohepatopathy spectrum ClinVar PMID:12707443 more ... Polg Rat colorectal cancer ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Familial colorectal cancer ClinVar PMID:28492532 Polg Rat D-2-hydroxyglutaric aciduria 2 ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: D-2-hydroxyglutaric aciduria 2 ClinVar PMID:17407155 and PMID:28492532 Polg Rat Developmental Disabilities ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Global developmental delay ClinVar PMID:11555352 more ... Polg Rat epilepsy ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Seizure ClinVar PMID:18156159 more ... Polg Rat epilepsy ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:15181170 more ... Polg Rat epilepsy ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Seizure ClinVar PMID:15181170 more ... Polg Rat epilepsy ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:34008892 more ... Polg Rat epilepsy ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat epilepsy ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat epilepsy ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:35307828 more ... Polg Rat epilepsy ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat epilepsy ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:7847370 Polg Rat epilepsy ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat Fanconi anemia ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:15477547 more ... Polg Rat Fanconi anemia complementation group I ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Fanconi anemia complementation group I ClinVar PMID:18414213 more ... Polg Rat genetic disease ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:29482223 more ... Polg Rat genetic disease ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:11431686 more ... Polg Rat hereditary spastic paraplegia ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Hereditary spastic paraplegia ClinVar PMID:11431686 more ... Polg Rat hereditary spastic paraplegia ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Hereditary spastic paraplegia ClinVar PMID:35861376 more ... Polg Rat hereditary spastic paraplegia ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Hereditary spastic paraplegia ClinVar PMID:11431686 more ... Polg Rat hereditary spastic paraplegia ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat hereditary spastic paraplegia ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Hereditary spastic paraplegia ClinVar PMID:11431686 more ... Polg Rat hereditary spastic paraplegia ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Hereditary spastic paraplegia ClinVar PMID:11431686 more ... Polg Rat hereditary spastic paraplegia ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Hereditary spastic paraplegia ClinVar PMID:11431686 more ... Polg Rat hereditary spastic paraplegia ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat hereditary spastic paraplegia ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat hypertrophic cardiomyopathy ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Hypertrophic cardiomyopathy ClinVar PMID:11555352 more ... Polg Rat intellectual disability ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:14745080 more ... Polg Rat intellectual disability ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:16401742 more ... Polg Rat Lennox-Gastaut syndrome ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Epileptic encephalopathy Lennox-Gastaut type ClinVar PMID:15181170 more ... Polg Rat MELAS syndrome ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:17436221 more ... Polg Rat microcephaly ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Microcephaly ClinVar PMID:25741868 Polg Rat mitochondrial DNA depletion syndrome ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Mitochondrial DNA depletion syndrome ClinVar PMID:11431686 more ... Polg Rat mitochondrial DNA depletion syndrome 1 ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat mitochondrial DNA depletion syndrome 1 ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat mitochondrial DNA depletion syndrome 4B ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:30451971 more ... Polg Rat mitochondrial DNA depletion syndrome 4B ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat mitochondrial DNA depletion syndrome 7 ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: mitochondrial hepatopathy ClinVar PMID:25741868 Polg Rat mitochondrial DNA depletion syndrome 8A ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat mitochondrial DNA depletion syndrome 8A ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat mitochondrial DNA depletion syndrome 8A ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat mitochondrial DNA depletion syndrome 8A ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat Mitochondrial DNA Depletion Syndrome, MNGIE Type ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat mitochondrial metabolism disease ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:35860755 more ... Polg Rat mitochondrial metabolism disease ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat Nervous System Malformations ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Abnormality of the nervous system ClinVar PMID:11555352 more ... Polg Rat Parkinson's disease 20 ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Early-onset Parkinson disease 20 ClinVar PMID:18414213 more ... Polg Rat Plagiocephaly ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Plagiocephaly ClinVar PMID:21550804 more ... Polg Rat polyneuropathy ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Polyneuropathy ClinVar Polg Rat Primary Ovarian Failure ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Primary ovarian failure ClinVar PMID:14635118 more ... Polg Rat primary ovarian insufficiency ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Premature ovarian failure ClinVar PMID:14635118 more ... Polg Rat primary progressive multiple sclerosis ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Primary progressive multiple sclerosis ClinVar PMID:16401742 more ... Polg Rat Progressive External Ophthalmoplegia with Mitochondrial DNA Deletions, Autosomal Recessive ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Progressive external ophthalmoplegia with mitochondrial DNA deletions and digenic ClinVar PMID:12210792 more ... Polg Rat progressive myoclonus epilepsy 5 ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:34062649 more ... Polg Rat progressive myoclonus epilepsy 5 ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Epilepsy more ... ClinVar PMID:30306720 more ... Polg Rat progressive myoclonus epilepsy 5 ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Epilepsy more ... ClinVar PMID:11431686 more ... Polg Rat progressive myoclonus epilepsy 5 ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:30369941 more ... Polg Rat progressive myoclonus epilepsy 5 ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Epilepsy more ... ClinVar PMID:11431686 more ... Polg Rat progressive myoclonus epilepsy 5 ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Epilepsy more ... ClinVar PMID:33600046 more ... Polg Rat progressive myoclonus epilepsy 5 ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat progressive myoclonus epilepsy 5 ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Epilepsy more ... ClinVar PMID:11431686 more ... Polg Rat progressive myoclonus epilepsy 5 ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:33683010 more ... Polg Rat progressive myoclonus epilepsy 5 ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat progressive myoclonus epilepsy 5 ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Epilepsy more ... ClinVar PMID:33683010 more ... Polg Rat progressive myoclonus epilepsy 5 ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat sensory ataxic neuropathy, dysarthria, and ophthalmoparesis ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:30255931 more ... Polg Rat sensory ataxic neuropathy, dysarthria, and ophthalmoparesis ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat sensory ataxic neuropathy, dysarthria, and ophthalmoparesis ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat sensory ataxic neuropathy, dysarthria, and ophthalmoparesis ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ... Polg Rat Spinocerebellar Ataxia with Epilepsy ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Spinocerebellar ataxia with epilepsy ClinVar PMID:11431686 more ... Polg Rat Spinocerebellar Ataxias ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Spinocerebellar atrophy ClinVar PMID:17436221 more ... Polg Rat vascular dementia ISO POLG (Homo sapiens) 8554872 ClinVar Annotator: match by term: Vascular dementia ClinVar PMID:25741868 more ... Polg Rat visual epilepsy ISO POLG (Homo sapiens) 8554872 ClinVar more ... ClinVar PMID:11431686 more ...
Only show annotations with direct experimental evidence (0 objects hidden)
Polg Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of POLG mRNA and Pilocarpine results in increased expression of POLG protein CTD PMID:20446108 Polg Rat (1->4)-beta-D-glucan multiple interactions ISO Polg (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of POLG mRNA CTD PMID:36331819 Polg Rat 1,2-dimethylhydrazine multiple interactions ISO Polg (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of POLG mRNA CTD PMID:22206623 Polg Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of POLG mRNA CTD PMID:35192832 Polg Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO POLG (Homo sapiens) 6480464 [Triiodothyronine co-treated with Tetrachlorodibenzodioxin] results in decreased expression of POLG mRNA CTD PMID:14761676 Polg Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Polg (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of POLG mRNA CTD PMID:21570461 Polg Rat 2-hydroxypropanoic acid increases chemical synthesis ISO Polg (Mus musculus) 6480464 POLG gene mutant form results in increased chemical synthesis of Lactic Acid CTD PMID:30038268 Polg Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Polg Rat 3,3',5-triiodo-L-thyronine multiple interactions ISO POLG (Homo sapiens) 6480464 [Triiodothyronine co-treated with Tetrachlorodibenzodioxin] results in decreased expression of POLG mRNA CTD PMID:14761676 Polg Rat 4,4'-diaminodiphenylmethane increases expression ISO Polg (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of POLG mRNA CTD PMID:18648102 Polg Rat 4,4'-sulfonyldiphenol decreases expression ISO Polg (Mus musculus) 6480464 bisphenol S results in decreased expression of POLG mRNA CTD PMID:39298647 Polg Rat 4,4'-sulfonyldiphenol decreases methylation ISO Polg (Mus musculus) 6480464 bisphenol S results in decreased methylation of POLG exon CTD PMID:33297965 Polg Rat 5-fluorouracil affects response to substance ISO POLG (Homo sapiens) 6480464 POLG protein affects the susceptibility to Fluorouracil CTD PMID:15548681 Polg Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of POLG mRNA CTD PMID:31881176 Polg Rat acetohydrazide decreases expression ISO Polg (Mus musculus) 6480464 acetylhydrazine results in decreased expression of POLG mRNA CTD PMID:15282401 Polg Rat acrolein multiple interactions ISO POLG (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of POLG mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of POLG mRNA CTD PMID:32699268 Polg Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of POLG mRNA CTD PMID:28959563 Polg Rat acrylamide decreases expression ISO POLG (Homo sapiens) 6480464 Acrylamide results in decreased expression of POLG mRNA CTD PMID:32763439 Polg Rat aflatoxin B1 increases expression ISO Polg (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of POLG mRNA CTD PMID:19770486 Polg Rat alpha-pinene multiple interactions ISO POLG (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of POLG mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of POLG mRNA CTD PMID:32699268 Polg Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of POLG mRNA CTD PMID:16483693 Polg Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of POLG mRNA CTD PMID:30779732 Polg Rat amphotericin B increases expression ISO POLG (Homo sapiens) 6480464 Amphotericin B analog results in increased expression of POLG mRNA and Amphotericin B results in increased expression of POLG mRNA CTD PMID:28534445 Polg Rat arsane affects methylation ISO POLG (Homo sapiens) 6480464 Arsenic affects the methylation of POLG gene CTD PMID:25304211 Polg Rat arsenic atom affects methylation ISO POLG (Homo sapiens) 6480464 Arsenic affects the methylation of POLG gene CTD PMID:25304211 Polg Rat arsenite(3-) multiple interactions ISO POLG (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to POLG mRNA] CTD PMID:32406909 Polg Rat aspartame multiple interactions ISO Polg (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Polg Rat atrazine increases expression ISO POLG (Homo sapiens) 6480464 Atrazine results in increased expression of POLG mRNA CTD PMID:22378314 Polg Rat benzo[a]pyrene increases mutagenesis ISO POLG (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of POLG gene CTD PMID:25435355 Polg Rat benzo[a]pyrene decreases methylation ISO POLG (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of POLG promoter CTD PMID:27901495 Polg Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of POLG protein CTD PMID:21467743 Polg Rat benzo[a]pyrene increases expression ISO Polg (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of POLG mRNA CTD PMID:20504355 Polg Rat Benzo[ghi]perylene increases expression ISO POLG (Homo sapiens) 6480464 1 and 12-benzoperylene results in increased expression of POLG mRNA CTD PMID:31518672 Polg Rat bis(2-ethylhexyl) phthalate increases expression ISO Polg (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of POLG mRNA CTD PMID:34319233 Polg Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of POLG mRNA CTD PMID:25181051 and PMID:32145629 Polg Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of POLG mRNA CTD PMID:35192832 Polg Rat bisphenol A increases expression ISO Polg (Mus musculus) 6480464 bisphenol A results in increased expression of POLG mRNA CTD PMID:33221593 Polg Rat cadmium atom multiple interactions ISO Polg (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of POLG mRNA CTD PMID:37325564 Polg Rat cadmium dichloride multiple interactions ISO Polg (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of POLG mRNA CTD PMID:37325564 Polg Rat calcium dihydroxide affects expression ISO Polg (Mus musculus) 6480464 Calcium Hydroxide affects the expression of POLG mRNA CTD PMID:30615914 Polg Rat carbamazepine affects expression ISO POLG (Homo sapiens) 6480464 Carbamazepine affects the expression of POLG mRNA CTD PMID:24752500 Polg Rat carbon monoxide increases expression ISO Polg (Mus musculus) 6480464 Carbon Monoxide results in increased expression of POLG mRNA and Carbon Monoxide results in increased expression of POLG protein CTD PMID:17179207 Polg Rat carbon nanotube decreases expression ISO Polg (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of POLG mRNA CTD PMID:25554681 and PMID:25620056 Polg Rat chloramphenicol increases expression ISO POLG (Homo sapiens) 6480464 Chloramphenicol results in increased expression of POLG mRNA CTD PMID:22712077 Polg Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of POLG mRNA CTD PMID:17602206 Polg Rat crocidolite asbestos decreases expression ISO Polg (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of POLG mRNA CTD PMID:29279043 Polg Rat diazinon increases methylation ISO POLG (Homo sapiens) 6480464 Diazinon results in increased methylation of POLG gene CTD PMID:22964155 Polg Rat diclofenac affects expression ISO POLG (Homo sapiens) 6480464 Diclofenac affects the expression of POLG mRNA CTD PMID:24752500 Polg Rat dimethylarsinic acid increases expression ISO Polg (Mus musculus) 6480464 Cacodylic Acid results in increased expression of POLG mRNA CTD PMID:17441966 Polg Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of POLG mRNA CTD PMID:30557669 Polg Rat doxorubicin increases expression ISO POLG (Homo sapiens) 6480464 Doxorubicin results in increased expression of POLG mRNA CTD PMID:29803840 Polg Rat favipiravir affects binding ISO POLG (Homo sapiens) 6480464 favipiravir binds to POLG1 protein CTD PMID:36152797 Polg Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of POLG mRNA CTD PMID:24136188 Polg Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of POLG mRNA CTD PMID:23962444 Polg Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of POLG mRNA CTD PMID:24136188 Polg Rat folic acid decreases expression ISO Polg (Mus musculus) 6480464 Folic Acid results in decreased expression of POLG mRNA CTD PMID:25629700 Polg Rat folic acid multiple interactions ISO Polg (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of POLG mRNA CTD PMID:22206623 Polg Rat furan increases methylation EXP 6480464 furan results in increased methylation of POLG gene CTD PMID:22079235 Polg Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of POLG mRNA CTD PMID:22061828 Polg Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of POLG mRNA CTD PMID:22061828 Polg Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of POLG mRNA CTD PMID:24136188 Polg Rat hydrazine decreases expression ISO Polg (Mus musculus) 6480464 hydrazine results in decreased expression of POLG mRNA CTD PMID:15282401 Polg Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of POLG mRNA CTD PMID:21396975 Polg Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of POLG mRNA CTD PMID:20080153 Polg Rat leflunomide decreases expression ISO POLG (Homo sapiens) 6480464 leflunomide results in decreased expression of POLG mRNA CTD PMID:28988120 and PMID:29427785 Polg Rat monosodium L-glutamate multiple interactions ISO Polg (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Polg Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of POLG mRNA and [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of POLG mRNA CTD PMID:17602206 and PMID:20360939 Polg Rat ozone multiple interactions ISO POLG (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of POLG mRNA more ... CTD PMID:32699268 and PMID:35430440 Polg Rat paracetamol affects expression ISO Polg (Mus musculus) 6480464 Acetaminophen affects the expression of POLG mRNA CTD PMID:17562736 Polg Rat paracetamol increases expression ISO POLG (Homo sapiens) 6480464 Acetaminophen results in increased expression of POLG mRNA CTD PMID:22230336 more ... Polg Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of POLG mRNA CTD PMID:16751229 and PMID:33387578 Polg Rat perfluorohexanesulfonic acid decreases expression ISO Polg (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of POLG mRNA CTD PMID:37995155 Polg Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of POLG mRNA CTD PMID:18692542 Polg Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Polg (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of POLG mRNA CTD PMID:36331819 Polg Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of POLG mRNA CTD PMID:20360939 Polg Rat pirinixic acid multiple interactions ISO Polg (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of POLG mRNA CTD PMID:19710929 Polg Rat rac-lactic acid increases chemical synthesis ISO Polg (Mus musculus) 6480464 POLG gene mutant form results in increased chemical synthesis of Lactic Acid CTD PMID:30038268 Polg Rat rotenone multiple interactions ISO Polg (Mus musculus) 6480464 Rotenone promotes the reaction [POLG gene mutant form results in increased chemical synthesis of Superoxides] CTD PMID:30038268 Polg Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of POLG protein CTD PMID:33515431 Polg Rat rotenone multiple interactions EXP 6480464 ZLN005 inhibits the reaction [Rotenone results in decreased expression of POLG protein] CTD PMID:33515431 Polg Rat sodium arsenite decreases expression ISO POLG (Homo sapiens) 6480464 sodium arsenite results in decreased expression of POLG mRNA CTD PMID:12760830 Polg Rat streptozocin affects expression ISO Polg (Mus musculus) 6480464 Streptozocin affects the expression of POLG mRNA CTD PMID:18583417 Polg Rat sunitinib affects response to substance ISO POLG (Homo sapiens) 6480464 POLG affects the susceptibility to sunitinib CTD PMID:26385865 Polg Rat sunitinib increases expression ISO POLG (Homo sapiens) 6480464 Sunitinib results in increased expression of POLG mRNA CTD PMID:31533062 Polg Rat sunitinib decreases expression ISO POLG (Homo sapiens) 6480464 sunitinib results in decreased expression of POLG mRNA and sunitinib results in decreased expression of POLG protein CTD PMID:26385865 Polg Rat superoxide increases chemical synthesis ISO Polg (Mus musculus) 6480464 POLG gene mutant form results in increased chemical synthesis of Superoxides CTD PMID:30038268 Polg Rat superoxide multiple interactions ISO Polg (Mus musculus) 6480464 Mn(III) meso-tetrakis(N-n-butoxyethylpyridinium-2-yl)porphyrin inhibits the reaction [POLG protein results in increased chemical synthesis of Superoxides] more ... CTD PMID:30038268 Polg Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of POLG mRNA CTD PMID:34492290 Polg Rat thiram increases expression ISO POLG (Homo sapiens) 6480464 Thiram results in increased expression of POLG mRNA CTD PMID:38568856 Polg Rat titanium dioxide decreases methylation ISO Polg (Mus musculus) 6480464 titanium dioxide results in decreased methylation of POLG gene CTD PMID:35295148 Polg Rat triphenyl phosphate affects expression ISO POLG (Homo sapiens) 6480464 triphenyl phosphate affects the expression of POLG mRNA CTD PMID:37042841 Polg Rat triptonide decreases expression ISO Polg (Mus musculus) 6480464 triptonide results in decreased expression of POLG mRNA CTD PMID:33045310 Polg Rat urethane increases expression ISO POLG (Homo sapiens) 6480464 Urethane results in increased expression of POLG mRNA CTD PMID:28818685 Polg Rat valproic acid increases response to substance ISO POLG (Homo sapiens) 6480464 POLG gene SNP results in increased susceptibility to Valproic Acid and POLG protein mutant form results in increased susceptibility to Valproic Acid CTD PMID:18716558 and PMID:20138553 Polg Rat valproic acid affects expression ISO Polg (Mus musculus) 6480464 Valproic Acid affects the expression of POLG mRNA CTD PMID:17292431
(+)-pilocarpine (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5-triiodo-L-thyronine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) acetamide (EXP) acetohydrazide (ISO) acrolein (ISO) acrylamide (EXP,ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) ammonium chloride (EXP) amphetamine (EXP) amphotericin B (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) aspartame (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) Benzo[ghi]perylene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcium dihydroxide (ISO) carbamazepine (ISO) carbon monoxide (ISO) carbon nanotube (ISO) chloramphenicol (ISO) clofibric acid (EXP) crocidolite asbestos (ISO) diazinon (ISO) diclofenac (ISO) dimethylarsinic acid (ISO) doxorubicin (EXP,ISO) favipiravir (ISO) finasteride (EXP) fipronil (EXP) flutamide (EXP) folic acid (ISO) furan (EXP) gentamycin (EXP) glafenine (EXP) hydrazine (ISO) indole-3-methanol (EXP) ketamine (EXP) leflunomide (ISO) monosodium L-glutamate (ISO) N-nitrosodiethylamine (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) phenethyl caffeate (EXP) pirinixic acid (ISO) rac-lactic acid (ISO) rotenone (EXP,ISO) sodium arsenite (ISO) streptozocin (ISO) sunitinib (ISO) superoxide (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO)
Cellular Component
gamma DNA polymerase complex (IDA,IEA,ISO) intracellular membrane-bounded organelle (IEA,ISO) mitochondrial chromosome (IEA,ISO) mitochondrial matrix (IEA,ISO) mitochondrial nucleoid (IEA,ISO,ISS) mitochondrion (IBA,IEA,ISO) protein-containing complex (IEA,ISO) terminal bouton (IDA)
Molecular Function
3'-5' exonuclease activity (IBA,IEA,ISO) 5'-deoxyribose-5-phosphate lyase activity (IEA,ISO,ISS) chromatin binding (IEA,ISO,ISS) DNA binding (IEA,ISO) DNA polymerase activity (IEA) DNA-directed DNA polymerase activity (IBA,IDA,IEA,ISO) exonuclease activity (ISO) hydrolase activity (IEA) lyase activity (IEA) metal ion binding (IEA) nucleotidyltransferase activity (IEA) protease binding (IEA,ISO) protein binding (ISO) single-stranded DNA 3'-5' DNA exonuclease activity (IEA,ISO,ISS) transferase activity (IEA)
1.
Mono-allelic POLG expression resulting from nonsense-mediated decay and alternative splicing in a patient with Alpers syndrome.
Chan SS, etal., DNA Repair (Amst). 2005 Dec 8;4(12):1381-9. Epub 2005 Sep 21.
2.
Oxidative stress-induced retinal damage up-regulates DNA polymerase gamma and 8-oxoguanine-DNA-glycosylase in photoreceptor synaptic mitochondria.
Cortina MS, etal., Exp Eye Res. 2005 Dec;81(6):742-50. Epub 2005 Jun 24.
3.
Effects of mitochondrial mutations on hearing and cochlear pathology with age.
Crawley BK and Keithley EM, Hear Res. 2011 Oct;280(1-2):201-8. doi: 10.1016/j.heares.2011.05.015. Epub 2011 Jun 1.
4.
Early-onset familial parkinsonism due to POLG mutations.
Davidzon G, etal., Ann Neurol. 2006 May;59(5):859-62.
5.
Novel polymerase gamma (POLG1) gene mutation in the linker domain associated with parkinsonism.
Dolhun R, etal., BMC Neurol. 2013 Jul 18;13:92. doi: 10.1186/1471-2377-13-92.
6.
POLG1 variations presenting as multiple sclerosis.
Echaniz-Laguna A, etal., Arch Neurol. 2010 Sep;67(9):1140-3. doi: 10.1001/archneurol.2010.219.
7.
POLG1 mutations cause a syndromic epilepsy with occipital lobe predilection.
Engelsen BA, etal., Brain. 2008 Mar;131(Pt 3):818-28. doi: 10.1093/brain/awn007. Epub 2008 Jan 30.
8.
Infantile hepatocerebral syndromes associated with mutations in the mitochondrial DNA polymerase-gammaA.
Ferrari G, etal., Brain. 2005 Apr;128(Pt 4):723-31. Epub 2005 Feb 2.
9.
Clinical and genetic heterogeneity in progressive external ophthalmoplegia due to mutations in polymerase gamma.
Filosto M, etal., Arch Neurol. 2003 Sep;60(9):1279-84.
10.
Sensory ataxic neuropathy with dysarthria/dysphagia and ophthalmoplegia (SANDO). Two case reports.
Gati I, etal., Acta Myol. 2011 Dec;30(3):188-90.
11.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
12.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
13.
Association of novel POLG mutations and multiple mitochondrial DNA deletions with variable clinical phenotypes in a Spanish population.
Gonzalez-Vioque E, etal., Arch Neurol. 2006 Jan;63(1):107-11.
14.
Mutation of the linker region of the polymerase gamma-1 (POLG1) gene associated with progressive external ophthalmoplegia and Parkinsonism.
Hudson G, etal., Arch Neurol. 2007 Apr;64(4):553-7.
15.
Variants p.Q1236H and p.E1143G in mitochondrial DNA polymerase gamma POLG1 are not associated with increased risk for valproate-induced hepatotoxicity or pancreatic toxicity: A retrospective cohort study of patients with epilepsy.
Hynynen J, etal., Epilepsia. 2018 Nov;59(11):2125-2136. doi: 10.1111/epi.14568. Epub 2018 Sep 26.
16.
Acute liver failure after valproate exposure in patients with POLG1 mutations and the prognosis after liver transplantation.
Hynynen J, etal., Liver Transpl. 2014 Nov;20(11):1402-12. doi: 10.1002/lt.23965. Epub 2014 Oct 3.
17.
Mitochondrial DNA damage and impaired base excision repair during epileptogenesis.
Jarrett SG, etal., Neurobiol Dis. 2008 Apr;30(1):130-8. Epub 2008 Jan 5.
18.
Induction of DNA polymerase beta and gamma in the lungs of age-related oxygen tolerant rats.
Jinno S, etal., Mech Ageing Dev. 1995 Nov 24;85(2-3):95-107.
19.
Age-related changes in the induction of DNA polymerases in rat liver by gamma-ray irradiation.
Kaneko T, etal., Mech Ageing Dev. 2002 Sep;123(11):1521-8.
20.
Mice with neuron-specific accumulation of mitochondrial DNA mutations show mood disorder-like phenotypes.
Kasahara T, etal., Mol Psychiatry. 2006 Jun;11(6):577-93, 523.
21.
POLG1 mutations associated with progressive encephalopathy in childhood.
Kollberg G, etal., J Neuropathol Exp Neurol. 2006 Aug;65(8):758-68.
22.
A novel POLG gene mutation in 4 children with Alpers-like hepatocerebral syndromes.
Kurt B, etal., Arch Neurol. 2010 Feb;67(2):239-44. doi: 10.1001/archneurol.2009.332.
23.
Evidence for a direct role of the DNA polymerase gamma in the replication of the human mitochondrial DNA in vitro.
Lestienne P Biochem Biophys Res Commun 1987 Aug 14;146(3):1146-53.
24.
Decreased mtDNA, oxidative stress, cardiomyopathy, and death from transgenic cardiac targeted human mutant polymerase gamma.
Lewis W, etal., Lab Invest. 2007 Apr;87(4):326-35. Epub 2006 Feb 19.
25.
Polymorphisms in POLG were associated with the prognosis and mtDNA content in hepatocellular carcinoma patients.
Long X, etal., Bull Cancer. 2017 Jun;104(6):500-507. doi: 10.1016/j.bulcan.2017.02.005. Epub 2017 Apr 28.
26.
Parkinsonism, premature menopause, and mitochondrial DNA polymerase gamma mutations: clinical and molecular genetic study.
Luoma P, etal., Lancet. 2004 Sep 4-10;364(9437):875-82.
27.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
28.
Sensory ataxic neuropathy with ophthalmoparesis caused by POLG mutations.
Milone M, etal., Neuromuscul Disord. 2008 Aug;18(8):626-32. doi: 10.1016/j.nmd.2008.05.009. Epub 2008 Jun 27.
29.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
30.
Increase in DNA polymerase gamma in the hearts of adriamycin-administered rats.
Ogihara M, etal., Exp Mol Pathol 2002 Dec;73(3):234-41.
31.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
32.
Dominant inheritance of premature ovarian failure associated with mutant mitochondrial DNA polymerase gamma.
Pagnamenta AT, etal., Hum Reprod. 2006 Oct;21(10):2467-73. Epub 2006 Apr 4.
33.
GOA pipeline
RGD automated data pipeline
34.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
35.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
36.
Cloning and characterization of the human mitochondrial DNA polymerase, DNA polymerase gamma.
Ropp PA and Copeland WC, Genomics 1996 Sep 15;36(3):449-58.
37.
POLG, but not PEO1, is a frequent cause of cerebellar ataxia in Central Europe.
Schicks J, etal., Mov Disord. 2010 Nov 15;25(15):2678-82. doi: 10.1002/mds.23286.
38.
Phenotypic and genotypic variability in Alpers syndrome.
Sofou K, etal., Eur J Paediatr Neurol. 2012 Jul;16(4):379-89. doi: 10.1016/j.ejpn.2011.12.006. Epub 2012 Jan 10.
39.
Damaged mitochondrial DNA replication system and the development of diabetic retinopathy.
Tewari S, etal., Antioxid Redox Signal. 2012 Aug 1;17(3):492-504. doi: 10.1089/ars.2011.4333. Epub 2012 Feb 17.
40.
Mitochondria DNA replication and DNA methylation in the metabolic memory associated with continued progression of diabetic retinopathy.
Tewari S, etal., Invest Ophthalmol Vis Sci. 2012 Jul 24;53(8):4881-8. doi: 10.1167/iovs.12-9732.
41.
Premature ageing in mice expressing defective mitochondrial DNA polymerase.
Trifunovic A, etal., Nature. 2004 May 27;429(6990):417-23.
42.
Novel POLG mutations in progressive external ophthalmoplegia mimicking mitochondrial neurogastrointestinal encephalomyopathy.
Van Goethem G, etal., Eur J Hum Genet. 2003 Jul;11(7):547-9.
43.
Mutation of POLG is associated with progressive external ophthalmoplegia characterized by mtDNA deletions.
Van Goethem G, etal., Nat Genet 2001 Jul;28(3):211-2.
44.
Recessive POLG mutations presenting with sensory and ataxic neuropathy in compound heterozygote patients with progressive external ophthalmoplegia.
Van Goethem G, etal., Neuromuscul Disord. 2003 Feb;13(2):133-42.
45.
Autosomal recessive mitochondrial ataxic syndrome due to mitochondrial polymerase gamma mutations.
Winterthun S, etal., Neurology. 2005 Apr 12;64(7):1204-8.
Polg Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 142,792,119 - 142,808,933 (-) NCBI GRCr8 mRatBN7.2 1 133,382,764 - 133,399,578 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 133,382,766 - 133,398,567 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 141,292,744 - 141,307,834 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 148,462,157 - 148,477,247 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 141,379,870 - 141,394,960 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 141,172,117 - 141,188,893 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 141,172,531 - 141,188,031 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 142,133,892 - 142,150,597 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 135,197,075 - 135,212,178 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 135,275,417 - 135,290,521 (-) NCBI Celera 1 125,446,563 - 125,461,666 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
POLG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 89,316,320 - 89,334,824 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 89,305,198 - 89,334,861 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 89,859,551 - 89,878,055 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 87,660,554 - 87,679,030 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 87,660,552 - 87,679,030 NCBI Celera 15 66,260,895 - 66,279,201 (-) NCBI Celera Cytogenetic Map 15 q26.1 NCBI HuRef 15 65,971,419 - 65,989,730 (-) NCBI HuRef CHM1_1 15 89,700,576 - 89,719,066 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 87,071,147 - 87,089,647 (-) NCBI T2T-CHM13v2.0
Polg Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 79,095,979 - 79,117,659 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 79,095,979 - 79,116,110 (-) Ensembl GRCm39 Ensembl GRCm38 7 79,446,231 - 79,467,911 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 79,446,231 - 79,466,362 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 86,594,269 - 86,611,159 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 79,322,896 - 79,339,786 (-) NCBI MGSCv36 mm8 Celera 7 76,851,749 - 76,868,637 (-) NCBI Celera Cytogenetic Map 7 D2 NCBI cM Map 7 45.04 NCBI
Polg Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 15,773,473 - 15,788,651 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 15,773,005 - 15,788,736 (+) NCBI ChiLan1.0 ChiLan1.0
POLG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 78,864,098 - 78,883,228 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 82,568,484 - 82,587,617 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 68,008,214 - 68,028,241 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 87,214,451 - 87,234,739 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 87,214,451 - 87,234,739 (-) Ensembl panpan1.1 panPan2
POLG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 52,357,062 - 52,373,768 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 52,357,068 - 52,421,544 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 54,991,836 - 55,008,948 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 52,774,064 - 52,791,169 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 52,774,083 - 52,790,068 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 52,296,790 - 52,313,882 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 52,507,050 - 52,523,743 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 52,846,762 - 52,863,883 (-) NCBI UU_Cfam_GSD_1.0
Polg Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 131,138,186 - 131,155,546 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936483 15,179,342 - 15,195,258 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936483 15,178,947 - 15,196,277 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
POLG Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 54,889,157 - 54,906,844 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 54,889,150 - 54,907,167 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 59,864,727 - 59,882,439 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
POLG Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 7,864,319 - 7,881,577 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 7,863,277 - 7,882,068 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 38,932,949 - 38,951,612 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Polg
.
Predicted Target Of
Count of predictions: 134 Count of miRNA genes: 102 Interacting mature miRNAs: 113 Transcripts: ENSRNOT00000044567 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 631570 Bp94 Blood pressure QTL 94 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123479780 142990467 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631202 Gluco13 Glucose level QTL 13 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 131763437 159756369 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
MARC_7859-7860:996688105:3
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 142,792,761 - 142,793,348 (+) Marker Load Pipeline mRatBN7.2 1 133,383,406 - 133,383,993 (+) MAPPER mRatBN7.2 Rnor_6.0 1 141,172,760 - 141,173,346 NCBI Rnor6.0 Rnor_5.0 1 142,134,535 - 142,135,121 UniSTS Rnor5.0 RGSC_v3.4 1 135,197,105 - 135,197,691 UniSTS RGSC3.4 Celera 1 125,446,593 - 125,447,179 UniSTS Cytogenetic Map 1 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000044567 ⟹ ENSRNOP00000047900
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 133,382,766 - 133,398,567 (-) Ensembl Rnor_6.0 Ensembl 1 141,172,531 - 141,188,031 (-) Ensembl
RefSeq Acc Id:
NM_053528 ⟹ NP_445980
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 142,792,119 - 142,808,838 (-) NCBI mRatBN7.2 1 133,382,764 - 133,399,483 (-) NCBI Rnor_6.0 1 141,172,730 - 141,187,833 (-) NCBI Rnor_5.0 1 142,133,892 - 142,150,597 (-) NCBI RGSC_v3.4 1 135,197,075 - 135,212,178 (-) RGD Celera 1 125,446,563 - 125,461,666 (-) RGD
Sequence:
ATGAGCCGCCTGCTCTGGAAGAAGGTGGCCGGCGCCAAAGTCGCCTCAGGGCCAGTACCAGCAACAGGACGCTGGGTCTCCAGCTCCGTCCTCGACCCCGTCCCCAGCGACGGGCAGCCGCAGTCGCA
hide sequence
RefSeq Acc Id:
XM_008759561 ⟹ XP_008757783
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 142,792,119 - 142,808,928 (-) NCBI mRatBN7.2 1 133,382,764 - 133,399,568 (-) NCBI Rnor_6.0 1 141,172,117 - 141,188,893 (-) NCBI
Sequence:
CCGGGGAGTCTCCCGCCTGCCTCTGGGTAGCCGCGGGACCCAGTTCGCGCAGACGGGAAGTTGCGGCTGCTCTCCAGACCGCACGCCACCCGGAGGCTGCGTGGGCCGCGCGCAGCGGACGCCGCGTC
hide sequence
RefSeq Acc Id:
XM_039092948 ⟹ XP_038948876
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 142,792,119 - 142,808,933 (-) NCBI mRatBN7.2 1 133,382,764 - 133,399,571 (-) NCBI
RefSeq Acc Id:
XM_063275928 ⟹ XP_063131998
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 142,792,119 - 142,808,728 (-) NCBI
RefSeq Acc Id:
XM_063275929 ⟹ XP_063131999
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 142,792,119 - 142,808,924 (-) NCBI
RefSeq Acc Id:
XM_063275941 ⟹ XP_063132011
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 142,792,119 - 142,808,928 (-) NCBI
RefSeq Acc Id:
NP_445980 ⟸ NM_053528
- UniProtKB:
Q9QYV8 (UniProtKB/Swiss-Prot), Q9QYV7 (UniProtKB/Swiss-Prot), A6JC54 (UniProtKB/TrEMBL)
- Sequence:
MSRLLWKKVAGAKVASGPVPATGRWVSSSVLDPVPSDGQPQSQMPSSENGQLRLNPLHIQMLSRGLHEQIFGCGGDVPDEAAVQRSIEHLRKHGLWGQPTTPLPDVQLRLPRLFGGNLDQHFRLLAQK
hide sequence
RefSeq Acc Id:
XP_008757783 ⟸ XM_008759561
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QQ69 (UniProtKB/TrEMBL)
- Sequence:
MSRLLWKKVAGAKVASGPVPATGRWVSSSVLDPVPSDGQPQSQMPSSENGQLRLNPLHIQMLSR
hide sequence
Ensembl Acc Id:
ENSRNOP00000047900 ⟸ ENSRNOT00000044567
RefSeq Acc Id:
XP_038948876 ⟸ XM_039092948
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063132011 ⟸ XM_063275941
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063131999 ⟸ XM_063275929
- Peptide Label:
isoform X2
- UniProtKB:
Q9QYV8 (UniProtKB/Swiss-Prot), Q9QYV7 (UniProtKB/Swiss-Prot), A6JC54 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131998 ⟸ XM_063275928
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QQ69 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-21
Polg
DNA polymerase gamma, catalytic subunit
Polg
polymerase (DNA) gamma, catalytic subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-03-09
Polg
polymerase (DNA) gamma, catalytic subunit
Polg
polymerase (DNA directed), gamma
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Polg
polymerase (DNA directed), gamma
DNA polymerase gamma
Name updated
1299863 APPROVED
2002-08-07
Polg
DNA polymerase gamma
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
activity present in heart
724601
gene_regulation
activity induced by adriamycin treatment
724601
