Symbol:
Vegfc
Name:
vascular endothelial growth factor C
RGD ID:
619800
Description:
Enables vascular endothelial growth factor receptor 3 binding activity. Involved in several processes, including positive regulation of blood vessel endothelial cell migration; positive regulation of protein autophosphorylation; and regulation of vascular endothelial growth factor receptor signaling pathway. Acts upstream of or within positive regulation of neuroblast proliferation. Predicted to be located in extracellular region and membrane. Predicted to be active in extracellular space. Biomarker of colon adenocarcinoma. Human ortholog(s) of this gene implicated in breast carcinoma and hereditary lymphedema ID. Orthologous to human VEGFC (vascular endothelial growth factor C); PARTICIPATES IN vascular endothelial growth factor signaling pathway; ceramide signaling pathway; cytokine mediated signaling pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
flt4 ligand; flt4-L; vascular endothelial growth factor-related protein; VEGF-C; VRP
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 44,445,293 - 44,560,887 (-) NCBI GRCr8 mRatBN7.2 16 37,712,251 - 37,827,845 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 37,712,262 - 37,827,848 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 43,068,855 - 43,184,449 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 46,429,675 - 46,545,267 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 41,783,170 - 41,898,773 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 40,440,371 - 40,555,178 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 40,440,207 - 40,555,576 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 40,216,307 - 40,331,753 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 40,624,435 - 40,739,692 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 40,624,509 - 40,739,767 (-) NCBI Celera 16 35,834,400 - 35,949,683 (-) NCBI Celera Cytogenetic Map 16 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Vegfc Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of VEGFC mRNA] CTD PMID:31150632 Vegfc Rat 1,2-dichloroethane decreases expression ISO Vegfc (Mus musculus) 6480464 ethylene dichloride results in decreased expression of VEGFC mRNA CTD PMID:28960355 Vegfc Rat 1,2-dimethylhydrazine multiple interactions ISO Vegfc (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of VEGFC mRNA CTD PMID:22206623 Vegfc Rat 1-chloro-2,4-dinitrobenzene increases expression ISO VEGFC (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased expression of VEGFC mRNA CTD PMID:25617811 Vegfc Rat 1-octadec-9-enoylglycero-3-phosphate increases expression ISO VEGFC (Homo sapiens) 6480464 lysophosphatidic acid results in increased expression of VEGFC mRNA CTD PMID:18642114 Vegfc Rat 1-octadec-9-enoylglycero-3-phosphate increases secretion ISO VEGFC (Homo sapiens) 6480464 lysophosphatidic acid results in increased secretion of VEGFC protein CTD PMID:18642114 Vegfc Rat 17beta-estradiol multiple interactions ISO VEGFC (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of VEGFC mRNA CTD PMID:30165855 Vegfc Rat 17beta-estradiol decreases expression ISO VEGFC (Homo sapiens) 6480464 Estradiol results in decreased expression of VEGFC mRNA CTD PMID:31614463 Vegfc Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Vegfc (Mus musculus) 6480464 AHR protein affects the reaction [Tetrachlorodibenzodioxin results in increased expression of VEGFC mRNA] CTD PMID:16214954 Vegfc Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Vegfc (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of VEGFC mRNA CTD PMID:21570461 Vegfc Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of VEGFC mRNA CTD PMID:20558275 and PMID:33387578 Vegfc Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Vegfc (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of VEGFC mRNA CTD PMID:12167310 more ... Vegfc Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO VEGFC (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Vegfc Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Vegfc (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Vegfc Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of VEGFC mRNA CTD PMID:21346803 Vegfc Rat 2-palmitoylglycerol increases expression ISO VEGFC (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of VEGFC mRNA CTD PMID:37199045 Vegfc Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Vegfc Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO VEGFC (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of VEGFC mRNA CTD PMID:28628672 Vegfc Rat 4'-epidoxorubicin multiple interactions ISO VEGFC (Homo sapiens) 6480464 VEGFC mRNA results in increased susceptibility to [Paclitaxel co-treated with Epirubicin co-treated with CMF regimen] CTD PMID:23146280 Vegfc Rat 4,4'-sulfonyldiphenol affects expression ISO Vegfc (Mus musculus) 6480464 bisphenol S affects the expression of VEGFC mRNA CTD PMID:30951980 Vegfc Rat 4-hydroxyphenyl retinamide increases expression ISO Vegfc (Mus musculus) 6480464 Fenretinide results in increased expression of VEGFC mRNA CTD PMID:28973697 Vegfc Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of VEGFC mRNA CTD PMID:24780913 Vegfc Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of VEGFC mRNA CTD PMID:25825206 Vegfc Rat 8-Br-cAMP increases expression ISO VEGFC (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of VEGFC mRNA CTD PMID:22079614 Vegfc Rat 9-cis-retinoic acid decreases expression ISO VEGFC (Homo sapiens) 6480464 Alitretinoin results in decreased expression of VEGFC mRNA CTD PMID:15982314 Vegfc Rat aflatoxin B1 increases expression ISO VEGFC (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of VEGFC mRNA CTD PMID:22100608 Vegfc Rat all-trans-4-oxoretinoic acid decreases expression ISO VEGFC (Homo sapiens) 6480464 4-oxoretinoic acid results in decreased expression of VEGFC mRNA CTD PMID:15982314 Vegfc Rat all-trans-retinoic acid decreases expression ISO VEGFC (Homo sapiens) 6480464 Tretinoin results in decreased expression of VEGFC mRNA CTD PMID:15982314 Vegfc Rat all-trans-retinoic acid decreases expression ISO Vegfc (Mus musculus) 6480464 Tretinoin results in decreased expression of VEGFC mRNA CTD PMID:16788091 Vegfc Rat all-trans-retinoic acid increases expression ISO VEGFC (Homo sapiens) 6480464 Tretinoin metabolite results in increased expression of VEGFC mRNA CTD PMID:15982314 Vegfc Rat AM-251 multiple interactions ISO VEGFC (Homo sapiens) 6480464 AM 251 inhibits the reaction [arachidonyl-2-chloroethylamide inhibits the reaction [lipopolysaccharide and Escherichia coli O111 B4 results in increased secretion of VEGFC protein]] CTD PMID:26467187 Vegfc Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of VEGFC mRNA CTD PMID:16483693 Vegfc Rat antirheumatic drug decreases expression ISO VEGFC (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of VEGFC mRNA CTD PMID:24449571 Vegfc Rat arachidonyl-2'-chloroethylamide multiple interactions ISO VEGFC (Homo sapiens) 6480464 AM 251 inhibits the reaction [arachidonyl-2-chloroethylamide inhibits the reaction [lipopolysaccharide more ... CTD PMID:26467187 Vegfc Rat aristolochic acid A decreases expression ISO VEGFC (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of VEGFC mRNA CTD PMID:33212167 Vegfc Rat arsane decreases expression ISO Vegfc (Mus musculus) 6480464 Arsenic results in decreased expression of VEGFC mRNA CTD PMID:19654921 Vegfc Rat arsane multiple interactions ISO VEGFC (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of VEGFC mRNA more ... CTD PMID:32525701 and PMID:39836092 Vegfc Rat arsenic atom decreases expression ISO Vegfc (Mus musculus) 6480464 Arsenic results in decreased expression of VEGFC mRNA CTD PMID:19654921 Vegfc Rat arsenic atom multiple interactions ISO VEGFC (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of VEGFC mRNA more ... CTD PMID:32525701 and PMID:39836092 Vegfc Rat arsenous acid multiple interactions ISO VEGFC (Homo sapiens) 6480464 [BIBR 1532 co-treated with Arsenic Trioxide] affects the expression of VEGFC mRNA CTD PMID:32645343 Vegfc Rat arsenous acid increases expression ISO VEGFC (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of VEGFC mRNA CTD PMID:26705709 Vegfc Rat arsenous acid decreases expression ISO VEGFC (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of VEGFC mRNA and Arsenic Trioxide results in decreased expression of VEGFC protein CTD PMID:19099632 and PMID:19804631 Vegfc Rat Azoxymethane multiple interactions EXP 6480464 [2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine co-treated with Azoxymethane] results in increased expression of VEGFC mRNA CTD PMID:18424890 Vegfc Rat Azoxymethane multiple interactions ISO Vegfc (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of VEGFC mRNA CTD PMID:29950665 Vegfc Rat baicalin multiple interactions EXP 6480464 baicalin inhibits the reaction [Streptozocin results in decreased expression of VEGFC mRNA] CTD PMID:34414639 Vegfc Rat bendroflumethiazide decreases expression EXP 6480464 Bendroflumethiazide results in decreased expression of VEGFC protein CTD PMID:20625077 Vegfc Rat benzo[a]pyrene decreases expression ISO Vegfc (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of VEGFC mRNA CTD PMID:21569818 Vegfc Rat benzo[a]pyrene increases expression ISO VEGFC (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of VEGFC mRNA CTD PMID:32234424 Vegfc Rat benzo[a]pyrene decreases methylation ISO VEGFC (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of VEGFC promoter CTD PMID:27901495 Vegfc Rat benzo[a]pyrene increases expression ISO Vegfc (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of VEGFC mRNA CTD PMID:22228805 and PMID:22610609 Vegfc Rat benzo[a]pyrene diol epoxide I decreases expression ISO VEGFC (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Vegfc Rat benzo[b]fluoranthene increases expression ISO Vegfc (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of VEGFC mRNA CTD PMID:26377693 Vegfc Rat berberine increases expression ISO VEGFC (Homo sapiens) 6480464 Berberine results in increased expression of VEGFC mRNA CTD PMID:26478571 Vegfc Rat bis(2-chloroethyl) sulfide multiple interactions ISO VEGFC (Homo sapiens) 6480464 IL10 protein affects the reaction [Mustard Gas affects the expression of VEGFC mRNA] CTD PMID:16173061 Vegfc Rat bis(2-chloroethyl) sulfide decreases expression ISO VEGFC (Homo sapiens) 6480464 Mustard Gas results in decreased expression of VEGFC mRNA CTD PMID:25102026 Vegfc Rat bis(2-ethylhexyl) phthalate affects expression EXP 6480464 Diethylhexyl Phthalate affects the expression of VEGFC mRNA CTD PMID:20920545 Vegfc Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of VEGFC mRNA CTD PMID:25181051 Vegfc Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of VEGFC mRNA CTD PMID:34947998 Vegfc Rat bisphenol A increases expression ISO VEGFC (Homo sapiens) 6480464 bisphenol A results in increased expression of VEGFC mRNA CTD PMID:31715268 Vegfc Rat bisphenol A increases expression ISO Vegfc (Mus musculus) 6480464 bisphenol A results in increased expression of VEGFC mRNA CTD PMID:30951980 Vegfc Rat bisphenol A multiple interactions ISO VEGFC (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of VEGFC mRNA CTD PMID:28628672 Vegfc Rat bisphenol F affects expression ISO Vegfc (Mus musculus) 6480464 bisphenol F affects the expression of VEGFC mRNA CTD PMID:30951980 Vegfc Rat bisphenol F multiple interactions ISO VEGFC (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in decreased methylation of VEGFC gene CTD PMID:31601247 Vegfc Rat BQ 123 multiple interactions ISO VEGFC (Homo sapiens) 6480464 cyclo(Trp-Asp-Pro-Val-Leu) inhibits the reaction [VEGFC protein results in decreased expression of CDKN1B protein] more ... CTD PMID:24184161 Vegfc Rat butanal decreases expression ISO VEGFC (Homo sapiens) 6480464 butyraldehyde results in decreased expression of VEGFC mRNA CTD PMID:26079696 Vegfc Rat cadmium atom multiple interactions ISO VEGFC (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of VEGFC mRNA CTD PMID:35301059 Vegfc Rat cadmium dichloride multiple interactions ISO VEGFC (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of VEGFC mRNA CTD PMID:35301059 Vegfc Rat carbon nanotube increases expression ISO Vegfc (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Vegfc Rat carbonyl sulfide increases expression EXP 6480464 carbonyl sulfide results in increased expression of VEGFC mRNA CTD PMID:19395590 Vegfc Rat chlorpyrifos increases expression ISO Vegfc (Mus musculus) 6480464 Chlorpyrifos results in increased expression of VEGFC mRNA CTD PMID:37019170 Vegfc Rat chlorthalidone decreases expression EXP 6480464 Chlorthalidone results in decreased expression of VEGFC mRNA and Chlorthalidone results in decreased expression of VEGFC protein CTD PMID:20625077 Vegfc Rat chlorthalidone increases expression EXP 6480464 Chlorthalidone results in increased expression of VEGFC protein CTD PMID:20625077 Vegfc Rat cobalt dichloride decreases expression ISO VEGFC (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of VEGFC mRNA CTD PMID:19320972 and PMID:19376846 Vegfc Rat copper atom multiple interactions ISO Vegfc (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of VEGFC mRNA CTD PMID:15467011 Vegfc Rat copper atom multiple interactions ISO VEGFC (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of VEGFC mRNA more ... CTD PMID:24690739 more ... Vegfc Rat copper(0) multiple interactions ISO Vegfc (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of VEGFC mRNA CTD PMID:15467011 Vegfc Rat copper(0) multiple interactions ISO VEGFC (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of VEGFC mRNA more ... CTD PMID:24690739 more ... Vegfc Rat copper(II) chloride increases expression ISO VEGFC (Homo sapiens) 6480464 cupric chloride results in increased expression of VEGFC mRNA CTD PMID:38568856 Vegfc Rat crocidolite asbestos increases expression ISO VEGFC (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of VEGFC mRNA CTD PMID:18687144 Vegfc Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of VEGFC mRNA CTD PMID:22528246 Vegfc Rat cytarabine multiple interactions ISO VEGFC (Homo sapiens) 6480464 EDN1 mutant form inhibits the reaction [VEGFC protein results in decreased susceptibility to Cytarabine] and PTGS2 mutant form inhibits the reaction [VEGFC protein results in decreased susceptibility to Cytarabine] CTD PMID:24184161 Vegfc Rat cytarabine multiple interactions ISO Vegfc (Mus musculus) 6480464 EDN1 mutant form affects the reaction [VEGFC protein results in decreased susceptibility to Cytarabine] and PTGS2 mutant form affects the reaction [VEGFC protein results in decreased susceptibility to Cytarabine] CTD PMID:24184161 Vegfc Rat cytarabine decreases response to substance ISO VEGFC (Homo sapiens) 6480464 VEGFC protein results in decreased susceptibility to Cytarabine CTD PMID:24184161 Vegfc Rat cytarabine decreases response to substance ISO Vegfc (Mus musculus) 6480464 VEGFC protein results in decreased susceptibility to Cytarabine CTD PMID:24184161 Vegfc Rat DDE decreases expression ISO VEGFC (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of VEGFC mRNA CTD PMID:38568856 Vegfc Rat dexamethasone multiple interactions ISO VEGFC (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of VEGFC mRNA CTD PMID:28628672 Vegfc Rat dexamethasone decreases expression ISO Vegfc (Mus musculus) 6480464 Dexamethasone results in decreased expression of VEGFC mRNA CTD PMID:25912570 Vegfc Rat dextran sulfate multiple interactions ISO Vegfc (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of VEGFC mRNA CTD PMID:29950665 Vegfc Rat diarsenic trioxide increases expression ISO VEGFC (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of VEGFC mRNA CTD PMID:26705709 Vegfc Rat diarsenic trioxide multiple interactions ISO VEGFC (Homo sapiens) 6480464 [BIBR 1532 co-treated with Arsenic Trioxide] affects the expression of VEGFC mRNA CTD PMID:32645343 Vegfc Rat diarsenic trioxide decreases expression ISO VEGFC (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of VEGFC mRNA and Arsenic Trioxide results in decreased expression of VEGFC protein CTD PMID:19099632 and PMID:19804631 Vegfc Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of VEGFC mRNA CTD PMID:22546817 Vegfc Rat dibenz[a,h]anthracene increases expression ISO Vegfc (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Vegfc Rat diclofenac decreases expression ISO Vegfc (Mus musculus) 6480464 Diclofenac results in decreased expression of VEGFC mRNA CTD PMID:35537566 Vegfc Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of VEGFC mRNA CTD PMID:22546817 Vegfc Rat dimethylarsinic acid increases expression ISO Vegfc (Mus musculus) 6480464 Cacodylic Acid results in increased expression of VEGFC mRNA CTD PMID:17441966 Vegfc Rat dioxygen multiple interactions ISO VEGFC (Homo sapiens) 6480464 Minocycline inhibits the reaction [Oxygen deficiency results in increased expression of VEGFC mRNA] CTD PMID:24292262 Vegfc Rat dioxygen increases expression ISO VEGFC (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of VEGFC mRNA CTD PMID:24292262 and PMID:26516004 Vegfc Rat disodium selenite increases expression ISO VEGFC (Homo sapiens) 6480464 Sodium Selenite results in increased expression of VEGFC mRNA CTD PMID:24383545 Vegfc Rat disulfiram multiple interactions ISO VEGFC (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of VEGFC mRNA CTD PMID:24690739 Vegfc Rat dorsomorphin multiple interactions ISO VEGFC (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of VEGFC mRNA CTD PMID:27188386 Vegfc Rat doxorubicin affects response to substance ISO VEGFC (Homo sapiens) 6480464 VEGFC protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Vegfc Rat doxorubicin decreases expression ISO VEGFC (Homo sapiens) 6480464 Doxorubicin results in decreased expression of VEGFC mRNA CTD PMID:29803840 Vegfc Rat etoposide multiple interactions ISO VEGFC (Homo sapiens) 6480464 EDN1 mutant form inhibits the reaction [VEGFC protein results in decreased susceptibility to Etoposide] and PTGS2 mutant form inhibits the reaction [VEGFC protein results in decreased susceptibility to Etoposide] CTD PMID:24184161 Vegfc Rat etoposide decreases response to substance ISO VEGFC (Homo sapiens) 6480464 VEGFC protein results in decreased susceptibility to Etoposide CTD PMID:24184161 Vegfc Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of VEGFC mRNA CTD PMID:24136188 and PMID:24793618 Vegfc Rat folic acid increases expression ISO Vegfc (Mus musculus) 6480464 Folic Acid results in increased expression of VEGFC protein CTD PMID:25912570 Vegfc Rat folic acid multiple interactions ISO Vegfc (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of VEGFC mRNA CTD PMID:22206623 Vegfc Rat fonofos increases methylation ISO VEGFC (Homo sapiens) 6480464 Fonofos results in increased methylation of VEGFC promoter CTD PMID:22847954 Vegfc Rat formaldehyde increases expression ISO VEGFC (Homo sapiens) 6480464 Formaldehyde results in increased expression of VEGFC mRNA CTD PMID:25617811 Vegfc Rat fulvestrant multiple interactions ISO VEGFC (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in decreased methylation of VEGFC gene CTD PMID:31601247 Vegfc Rat furosemide increases expression EXP 6480464 Furosemide results in increased expression of VEGFC mRNA CTD PMID:16526316 Vegfc Rat genistein decreases expression ISO VEGFC (Homo sapiens) 6480464 Genistein results in decreased expression of VEGFC mRNA CTD PMID:22228119 Vegfc Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of VEGFC mRNA CTD PMID:33387578 Vegfc Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of VEGFC mRNA CTD PMID:24915197 Vegfc Rat hexaconazole decreases expression ISO Vegfc (Mus musculus) 6480464 hexaconazole results in decreased expression of VEGFC mRNA CTD PMID:22045034 Vegfc Rat hexane decreases methylation EXP 6480464 n-hexane results in decreased methylation of VEGFC promoter CTD PMID:23740543 Vegfc Rat hydrogen chloride increases expression ISO VEGFC (Homo sapiens) 6480464 Hydrochloric Acid results in increased expression of VEGFC mRNA CTD PMID:15046208 Vegfc Rat indometacin multiple interactions ISO VEGFC (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of VEGFC mRNA CTD PMID:28628672 Vegfc Rat isotretinoin decreases expression ISO VEGFC (Homo sapiens) 6480464 Isotretinoin results in decreased expression of VEGFC mRNA CTD PMID:15982314 Vegfc Rat lead diacetate increases expression ISO VEGFC (Homo sapiens) 6480464 lead acetate results in increased expression of VEGFC mRNA CTD PMID:38568856 Vegfc Rat lipopolysaccharide increases expression ISO VEGFC (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of VEGFC mRNA CTD PMID:35811015 Vegfc Rat lipopolysaccharide multiple interactions ISO VEGFC (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of VEGFC mRNA] CTD PMID:35811015 Vegfc Rat losartan decreases expression ISO Vegfc (Mus musculus) 6480464 Losartan results in decreased expression of VEGFC mRNA CTD PMID:19771429 Vegfc Rat LY294002 multiple interactions ISO Vegfc (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [VEGFC protein results in increased phosphorylation of AKT1 protein] CTD PMID:29169284 Vegfc Rat maneb multiple interactions ISO Vegfc (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of VEGFC mRNA CTD PMID:36117858 Vegfc Rat manganese atom multiple interactions ISO VEGFC (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of VEGFC mRNA CTD PMID:39836092 Vegfc Rat manganese(0) multiple interactions ISO VEGFC (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of VEGFC mRNA CTD PMID:39836092 Vegfc Rat manganese(II) chloride increases expression ISO Vegfc (Mus musculus) 6480464 manganese chloride results in increased expression of VEGFC mRNA CTD PMID:17467022 Vegfc Rat manganese(II) chloride multiple interactions ISO VEGFC (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of VEGFC mRNA CTD PMID:39836092 Vegfc Rat methylparaben decreases expression ISO VEGFC (Homo sapiens) 6480464 methylparaben results in decreased expression of VEGFC mRNA CTD PMID:31745603 Vegfc Rat methylseleninic acid decreases expression ISO VEGFC (Homo sapiens) 6480464 methylselenic acid results in decreased expression of VEGFC mRNA CTD PMID:12517777 Vegfc Rat minocycline multiple interactions ISO VEGFC (Homo sapiens) 6480464 Minocycline inhibits the reaction [Oxygen deficiency results in increased expression of VEGFC mRNA] CTD PMID:24292262 Vegfc Rat naringin affects expression EXP 6480464 naringin affects the expression of VEGFC mRNA CTD PMID:24880026 Vegfc Rat nickel dichloride increases expression ISO VEGFC (Homo sapiens) 6480464 nickel chloride results in increased expression of VEGFC mRNA CTD PMID:17312168 Vegfc Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of VEGFC mRNA CTD PMID:22546817 Vegfc Rat nimesulide decreases expression ISO VEGFC (Homo sapiens) 6480464 nimesulide results in decreased expression of VEGFC mRNA and nimesulide results in decreased expression of VEGFC protein CTD PMID:18509974 Vegfc Rat NS-398 multiple interactions ISO VEGFC (Homo sapiens) 6480464 N-(2-cyclohexyloxy-4-nitrophenyl)methanesulfonamide inhibits the reaction [VEGFC protein results in decreased expression of CDKN1B protein] more ... CTD PMID:24184161 Vegfc Rat organoselenium compound multiple interactions ISO VEGFC (Homo sapiens) 6480464 [Organoselenium Compounds binds to Copper] which results in decreased expression of VEGFC mRNA CTD PMID:25167922 Vegfc Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of VEGFC mRNA CTD PMID:25729387 Vegfc Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of VEGFC mRNA CTD PMID:25729387 Vegfc Rat oxaliplatin increases expression ISO VEGFC (Homo sapiens) 6480464 oxaliplatin results in increased expression of VEGFC protein CTD PMID:18790786 Vegfc Rat ozone increases expression ISO VEGFC (Homo sapiens) 6480464 Ozone results in increased expression of VEGFC mRNA CTD PMID:31476115 Vegfc Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of VEGFC mRNA CTD PMID:26667334 Vegfc Rat p-menthan-3-ol decreases expression ISO VEGFC (Homo sapiens) 6480464 Menthol results in decreased expression of VEGFC mRNA CTD PMID:26760959 Vegfc Rat paclitaxel multiple interactions ISO VEGFC (Homo sapiens) 6480464 VEGFC mRNA results in increased susceptibility to [Paclitaxel co-treated with Epirubicin co-treated with CMF regimen] CTD PMID:23146280 Vegfc Rat paracetamol affects expression ISO Vegfc (Mus musculus) 6480464 Acetaminophen affects the expression of VEGFC mRNA CTD PMID:17562736 Vegfc Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of VEGFC mRNA CTD PMID:33387578 Vegfc Rat paraquat multiple interactions ISO Vegfc (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of VEGFC mRNA CTD PMID:36117858 Vegfc Rat parathion increases methylation ISO VEGFC (Homo sapiens) 6480464 Parathion results in increased methylation of VEGFC promoter CTD PMID:22847954 Vegfc Rat PD 0325901 multiple interactions ISO VEGFC (Homo sapiens) 6480464 [(+)-JQ1 compound co-treated with mirdametinib] results in decreased expression of VEGFC mRNA CTD PMID:25119042 Vegfc Rat PD 0325901 decreases expression ISO VEGFC (Homo sapiens) 6480464 mirdametinib results in decreased expression of VEGFC mRNA CTD PMID:25119042 Vegfc Rat PhIP multiple interactions EXP 6480464 [2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine co-treated with Azoxymethane] results in increased expression of VEGFC mRNA CTD PMID:18424890 Vegfc Rat prostaglandin E2 decreases expression ISO VEGFC (Homo sapiens) 6480464 Dinoprostone results in decreased expression of VEGFC mRNA and Dinoprostone results in decreased expression of VEGFC protein CTD PMID:18509974 Vegfc Rat rotenone increases expression ISO VEGFC (Homo sapiens) 6480464 Rotenone results in increased expression of VEGFC mRNA CTD PMID:29955902 Vegfc Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO VEGFC (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of VEGFC mRNA CTD PMID:35811015 Vegfc Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO VEGFC (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of VEGFC mRNA] CTD PMID:35811015 Vegfc Rat SB 203580 decreases secretion ISO VEGFC (Homo sapiens) 6480464 SB 203580 results in decreased secretion of VEGFC protein CTD PMID:19779139 Vegfc Rat SB 431542 multiple interactions ISO VEGFC (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of VEGFC mRNA CTD PMID:27188386 Vegfc Rat sildenafil citrate increases expression EXP 6480464 Sildenafil Citrate results in increased expression of VEGFC mRNA CTD PMID:20583517 Vegfc Rat silicon dioxide increases expression ISO VEGFC (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of VEGFC mRNA CTD PMID:25895662 Vegfc Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of VEGFC protein CTD PMID:37244296 Vegfc Rat silicon dioxide decreases expression ISO VEGFC (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of VEGFC mRNA CTD PMID:23806026 Vegfc Rat sodium arsenate multiple interactions ISO VEGFC (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of VEGFC mRNA CTD PMID:32525701 Vegfc Rat sodium arsenite increases expression ISO VEGFC (Homo sapiens) 6480464 sodium arsenite results in increased expression of VEGFC mRNA CTD PMID:38568856 Vegfc Rat sodium arsenite multiple interactions ISO VEGFC (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of VEGFC mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of VEGFC mRNA CTD PMID:39836092 Vegfc Rat sodium arsenite decreases expression ISO VEGFC (Homo sapiens) 6480464 sodium arsenite results in decreased expression of VEGFC mRNA CTD PMID:34032870 Vegfc Rat sodium dodecyl sulfate increases expression ISO VEGFC (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of VEGFC mRNA CTD PMID:25617811 Vegfc Rat sodium fluoride increases expression ISO Vegfc (Mus musculus) 6480464 Sodium Fluoride results in increased expression of VEGFC mRNA CTD PMID:27862939 Vegfc Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of VEGFC mRNA CTD PMID:34414639 Vegfc Rat streptozocin multiple interactions EXP 6480464 baicalin inhibits the reaction [Streptozocin results in decreased expression of VEGFC mRNA] CTD PMID:34414639 Vegfc Rat succimer multiple interactions ISO Vegfc (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of VEGFC mRNA CTD PMID:21641980 Vegfc Rat sulprostone increases expression ISO VEGFC (Homo sapiens) 6480464 sulprostone results in increased expression of VEGFC mRNA CTD PMID:20335389 Vegfc Rat sunitinib decreases expression ISO VEGFC (Homo sapiens) 6480464 Sunitinib results in decreased expression of VEGFC protein CTD PMID:18669461 and PMID:39025287 Vegfc Rat sunitinib increases expression ISO VEGFC (Homo sapiens) 6480464 Sunitinib results in increased expression of VEGFC mRNA CTD PMID:31533062 Vegfc Rat tebuconazole decreases expression ISO VEGFC (Homo sapiens) 6480464 tebuconazole results in decreased expression of VEGFC mRNA CTD PMID:26852204 Vegfc Rat temozolomide decreases expression ISO VEGFC (Homo sapiens) 6480464 Temozolomide results in decreased expression of VEGFC mRNA CTD PMID:31758290 Vegfc Rat terbufos increases methylation ISO VEGFC (Homo sapiens) 6480464 terbufos results in increased methylation of VEGFC promoter CTD PMID:22847954 Vegfc Rat tert-butyl hydroperoxide increases expression ISO VEGFC (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of VEGFC mRNA and tert-Butylhydroperoxide results in increased expression of VEGFC protein CTD PMID:15336504 and PMID:17200665 Vegfc Rat tert-butyl hydroperoxide increases secretion ISO VEGFC (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased secretion of VEGFC protein CTD PMID:17200665 Vegfc Rat tetrachloromethane affects expression ISO Vegfc (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of VEGFC mRNA CTD PMID:17484886 Vegfc Rat tetrachloromethane increases expression ISO Vegfc (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of VEGFC mRNA CTD PMID:31919559 Vegfc Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of VEGFC mRNA] CTD PMID:31150632 Vegfc Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of VEGFC mRNA CTD PMID:31150632 Vegfc Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of VEGFC mRNA CTD PMID:12734012 Vegfc Rat thalidomide affects expression ISO VEGFC (Homo sapiens) 6480464 Thalidomide affects the expression of VEGFC mRNA CTD PMID:29699374 Vegfc Rat theophylline increases expression ISO VEGFC (Homo sapiens) 6480464 Theophylline results in increased expression of VEGFC mRNA CTD PMID:16083514 Vegfc Rat thiram increases expression ISO VEGFC (Homo sapiens) 6480464 Thiram results in increased expression of VEGFC mRNA CTD PMID:38568856 Vegfc Rat titanium dioxide decreases expression ISO Vegfc (Mus musculus) 6480464 titanium dioxide results in decreased expression of VEGFC mRNA CTD PMID:23557971 and PMID:27760801 Vegfc Rat titanium dioxide decreases methylation ISO Vegfc (Mus musculus) 6480464 titanium dioxide results in decreased methylation of VEGFC gene CTD PMID:35295148 Vegfc Rat titanium dioxide multiple interactions ISO Vegfc (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of VEGFC mRNA CTD PMID:29950665 Vegfc Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of VEGFC mRNA CTD PMID:25729387 Vegfc Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of VEGFC mRNA CTD PMID:25729387 Vegfc Rat trichostatin A increases expression ISO VEGFC (Homo sapiens) 6480464 trichostatin A results in increased expression of VEGFC mRNA CTD PMID:24935251 Vegfc Rat triclosan decreases expression ISO VEGFC (Homo sapiens) 6480464 Triclosan results in decreased expression of VEGFC mRNA CTD PMID:30510588 Vegfc Rat troglitazone decreases expression ISO VEGFC (Homo sapiens) 6480464 troglitazone results in decreased expression of VEGFC mRNA CTD PMID:20846491 Vegfc Rat troglitazone decreases expression ISO Vegfc (Mus musculus) 6480464 troglitazone results in decreased expression of VEGFC mRNA CTD PMID:28973697 Vegfc Rat troglitazone increases expression ISO Vegfc (Mus musculus) 6480464 troglitazone results in increased expression of VEGFC mRNA CTD PMID:17569031 Vegfc Rat troglitazone multiple interactions ISO Vegfc (Mus musculus) 6480464 [Urethane co-treated with troglitazone] results in increased expression of VEGFC mRNA CTD PMID:18465119 Vegfc Rat trovafloxacin increases expression ISO Vegfc (Mus musculus) 6480464 trovafloxacin results in increased expression of VEGFC mRNA CTD PMID:35537566 Vegfc Rat undecane increases expression EXP 6480464 undecane results in increased expression of VEGFC protein CTD PMID:17337753 Vegfc Rat urethane multiple interactions ISO Vegfc (Mus musculus) 6480464 [Urethane co-treated with troglitazone] results in increased expression of VEGFC mRNA CTD PMID:18465119 Vegfc Rat urethane increases expression ISO Vegfc (Mus musculus) 6480464 Urethane results in increased expression of VEGFC mRNA CTD PMID:18465119 Vegfc Rat valproic acid decreases expression ISO Vegfc (Mus musculus) 6480464 Valproic Acid results in decreased expression of VEGFC mRNA CTD PMID:22045034 Vegfc Rat valproic acid increases expression ISO VEGFC (Homo sapiens) 6480464 Valproic Acid results in increased expression of VEGFC mRNA CTD PMID:24935251 Vegfc Rat valproic acid decreases expression ISO VEGFC (Homo sapiens) 6480464 Valproic Acid results in decreased expression of VEGFC mRNA CTD PMID:29154799 Vegfc Rat vincaleukoblastine affects response to substance ISO VEGFC (Homo sapiens) 6480464 VEGFC protein affects the susceptibility to Vinblastine CTD PMID:16217747 Vegfc Rat vorinostat increases expression ISO VEGFC (Homo sapiens) 6480464 vorinostat results in increased expression of VEGFC mRNA CTD PMID:26272509 Vegfc Rat vorinostat multiple interactions ISO VEGFC (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of VEGFC mRNA CTD PMID:27188386 Vegfc Rat zinc atom decreases expression EXP 6480464 Zinc results in decreased expression of VEGFC mRNA CTD PMID:17074742 Vegfc Rat zinc sulfate decreases expression EXP 6480464 Zinc Sulfate results in decreased expression of VEGFC mRNA CTD PMID:17074742 Vegfc Rat zinc(0) decreases expression EXP 6480464 Zinc results in decreased expression of VEGFC mRNA CTD PMID:17074742
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-octadec-9-enoylglycero-3-phosphate (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2-palmitoylglycerol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4'-epidoxorubicin (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) 9-cis-retinoic acid (ISO) aflatoxin B1 (ISO) all-trans-4-oxoretinoic acid (ISO) all-trans-retinoic acid (ISO) AM-251 (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) arachidonyl-2'-chloroethylamide (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) Azoxymethane (EXP,ISO) baicalin (EXP) bendroflumethiazide (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) berberine (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) BQ 123 (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) carbonyl sulfide (EXP) chlorpyrifos (ISO) chlorthalidone (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) crocidolite asbestos (ISO) cypermethrin (EXP) cytarabine (ISO) DDE (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) diazinon (EXP) dibenz[a,h]anthracene (ISO) diclofenac (ISO) dieldrin (EXP) dimethylarsinic acid (ISO) dioxygen (ISO) disodium selenite (ISO) disulfiram (ISO) dorsomorphin (ISO) doxorubicin (ISO) etoposide (ISO) flutamide (EXP) folic acid (ISO) fonofos (ISO) formaldehyde (ISO) fulvestrant (ISO) furosemide (EXP) genistein (ISO) gentamycin (EXP) glycidol (EXP) hexaconazole (ISO) hexane (EXP) hydrogen chloride (ISO) indometacin (ISO) isotretinoin (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) losartan (ISO) LY294002 (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methylparaben (ISO) methylseleninic acid (ISO) minocycline (ISO) naringin (EXP) nickel dichloride (EXP,ISO) nimesulide (ISO) NS-398 (ISO) organoselenium compound (ISO) oxaliplatin (EXP,ISO) ozone (EXP,ISO) p-menthan-3-ol (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) paraquat (ISO) parathion (ISO) PD 0325901 (ISO) PhIP (EXP) prostaglandin E2 (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 203580 (ISO) SB 431542 (ISO) sildenafil citrate (EXP) silicon dioxide (EXP,ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) sodium fluoride (ISO) streptozocin (EXP) succimer (ISO) sulprostone (ISO) sunitinib (ISO) tebuconazole (ISO) temozolomide (ISO) terbufos (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thalidomide (ISO) theophylline (ISO) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) triclosan (ISO) troglitazone (ISO) trovafloxacin (ISO) undecane (EXP) urethane (ISO) valproic acid (ISO) vincaleukoblastine (ISO) vorinostat (ISO) zinc atom (EXP) zinc sulfate (EXP) zinc(0) (EXP)
Biological Process
angiogenesis (IEA,IMP) animal organ morphogenesis (IEA,ISO) cell differentiation (IEA) cell population proliferation (IEA,ISO) cellular response to leukemia inhibitory factor (IEA,ISO) glial cell proliferation (IEA,ISO) induction of positive chemotaxis (IBA,IEA,ISO) morphogenesis of embryonic epithelium (IEA,ISO) negative regulation of blood pressure (IMP) negative regulation of osteoblast differentiation (IEA,ISO) positive chemotaxis (IEA) positive regulation of angiogenesis (IEA,ISO) positive regulation of blood vessel endothelial cell migration (IMP) positive regulation of cell division (IEA) positive regulation of cell migration (IEA,ISO) positive regulation of cell population proliferation (IDA,IEA,ISO) positive regulation of epithelial cell proliferation (IMP) positive regulation of glial cell proliferation (IEA,ISO) positive regulation of lymphangiogenesis (IEA,ISO) positive regulation of mast cell chemotaxis (IBA,IEA,ISO) positive regulation of mesenchymal stem cell proliferation (IEA,ISO) positive regulation of neuroblast proliferation (IDA) positive regulation of protein autophosphorylation (IMP) positive regulation of protein kinase activity (ISO) positive regulation of protein secretion (IMP) regulation of angiogenesis (TAS) regulation of vascular endothelial growth factor receptor signaling pathway (IMP) response to hypoxia (IBA) response to xenobiotic stimulus (IEP) signal transduction (IEA) sprouting angiogenesis (IBA) vascular endothelial growth factor receptor signaling pathway (IBA,IEA,ISO,ISS) vascular endothelial growth factor signaling pathway (IBA)
1.
Differential vascular endothelial growth factor A protein expression between small hepatocellular carcinoma and cirrhosis correlates with serum vascular endothelial growth factor A and alpha-fetoprotein.
Corradini SG, etal., Liver Int. 2009 Jan;29(1):103-12. doi: 10.1111/j.1478-3231.2008.01781.x. Epub 2008 Jun 9.
2.
Cyclooxygenase-2 expression is associated with vascular endothelial growth factor-C and lymph node metastases in human prostate cancer.
Di JM, etal., Arch Med Res. 2009 May;40(4):268-75. Epub 2009 Jun 4.
3.
Altered gene expression in rat colonic adenocarcinomas induced in an azoxymethane plus 2-amino-1-methyl-6-phenylimidazo[4,5-b]- pyridine initiation-promotion model.
Doi K, etal., Oncology. 2007;73(3-4):252-60. Epub 2008 Apr 17.
4.
[Correlation analysis of vascular endothelial growth factor-C expression and clinicopathology in breast cancer.]
Fu JM, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2009 Nov;29(11):2266-8.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Vascular endothelial growth factor stimulates rat cholangiocyte proliferation via an autocrine mechanism.
Gaudio E, etal., Gastroenterology. 2006 Apr;130(4):1270-82.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
Lentivirus-mediated small interfering RNA targeting VEGF-C inhibited tumor lymphangiogenesis and growth in breast carcinoma.
Guo B, etal., Anat Rec (Hoboken). 2009 May;292(5):633-9.
9.
The expression and clinical significance of pSTAT3, VEGF and VEGF-C in pancreatic adenocarcinoma.
Huang C, etal., Neoplasma. 2012;59(1):52-61. doi: 10.4149/neo_2012_007.
10.
Interpretation of Pin-1 and VEGF-C expression in breast infiltrating duct carcinoma.
Kim BC, etal., Oncol Rep. 2009 Dec;22(6):1381-90.
11.
Characterization of indolinones which preferentially inhibit VEGF-C- and VEGF-D-induced activation of VEGFR-3 rather than VEGFR-2.
Kirkin V, etal., Eur J Biochem 2001 Nov;268(21):5530-40.
12.
VEGF-C is a trophic factor for neural progenitors in the vertebrate embryonic brain.
Le Bras B, etal., Nat Neurosci. 2006 Mar;9(3):340-8. Epub 2006 Feb 5.
13.
Increasing lymphatic microvessel density in primary pterygia.
Ling S, etal., Arch Ophthalmol. 2012 Jun;130(6):735-42. doi: 10.1001/archophthalmol.2012.293.
14.
Macrophages regulate salt-dependent volume and blood pressure by a vascular endothelial growth factor-C-dependent buffering mechanism.
Machnik A, etal., Nat Med. 2009 May;15(5):545-52. Epub 2009 May 3.
15.
Molecular regulation of the VEGF family -- inducers of angiogenesis and lymphangiogenesis.
McColl BK, etal., APMIS 2004 Jul-Aug;112(7-8):463-80.
16.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
17.
Evaluation of the vascular endothelial growth factor (VEGF)-C role in urothelial carcinomas of the bladder.
Mylona E, etal., Anticancer Res. 2006 Sep-Oct;26(5A):3567-71.
18.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
19.
The significance of VEGF-C/VEGFR-2 interaction in the neovascularization and prognosis of nephroblastoma (Wilms' tumour).
Nowicki M, etal., Histopathology. 2007 Feb;50(3):358-64.
20.
VEGF receptor signalling - in control of vascular function.
Olsson AK, etal., Nat Rev Mol Cell Biol. 2006 May;7(5):359-71.
21.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
22.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
23.
GOA pipeline
RGD automated data pipeline
24.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
25.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
26.
Differential regulation of vascular endothelial growth factor-C and its receptor in the rat hippocampus following transient forebrain ischemia.
Shin YJ, etal., Acta Neuropathol. 2008 Nov;116(5):517-27. Epub 2008 Aug 15.
27.
Vascular endothelial growth factor C mRNA expression is a prognostic factor in epithelial ovarian cancer as detected by kinetic RT-PCR in formalin-fixed paraffin-embedded tissue.
Sinn BV, etal., Virchows Arch. 2009 Nov 13.
28.
Expression of vascular endothelial growth factor family messenger RNA in diseased thyroid tissues.
Tanaka K, etal., Surg Today. 2002;32(9):761-8.
29.
The expression of vascular endothelial growth factor-A and -C, and receptors 1 and 3: correlation with lymph node metastasis and prognosis in tongue squamous cell carcinoma.
Tanigaki Y, etal., Int J Mol Med. 2004 Sep;14(3):389-95.
30.
Vascular endothelial growth factor (VEGF) receptor-2 signaling mediates VEGF-C(deltaNdeltaC)- and VEGF-A-induced angiogenesis in vitro.
Tille JC, etal., Exp Cell Res. 2003 May 1;285(2):286-98.
31.
Effect of pentoxifylline on vascular endothelial growth factor C and flk-1 expression on endometrial implants in the rat endometriosis model.
Vlahos NF, etal., Fertil Steril. 2009 Jan 13.
32.
The lymphatic system and its specific growth factor vascular endothelial growth factor C in kidney tissue and in renal cell carcinoma.
Voss M, etal., BJU Int. 2009 Jul;104(1):94-9. Epub 2008 Dec 19.
33.
Distinct characteristics of circulating vascular endothelial growth factor-a and C levels in human subjects.
Wada H, etal., PLoS One. 2011;6(12):e29351. doi: 10.1371/journal.pone.0029351. Epub 2011 Dec 20.
34.
The role of VEGF-C/D and Flt-4 in the lymphatic metastasis of early-stage invasive cervical carcinoma.
Yu H, etal., J Exp Clin Cancer Res. 2009 Jul 9;28:98.
35.
Expression of vascular endothelial growth factors-C and -D correlate with evidence of lymphangiogenesis and angiogenesis in pancreatic adenocarcinoma.
Zhang B, etal., Cancer Detect Prev. 2007;31(6):436-42. doi: 10.1016/j.cdp.2007.10.016.
36.
Vascular endothelial growth factor-C expression in bladder transitional cell cancer and its relationship to lymph node metastasis.
Zu X, etal., BJU Int. 2006 Nov;98(5):1090-3.
Vegfc Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 44,445,293 - 44,560,887 (-) NCBI GRCr8 mRatBN7.2 16 37,712,251 - 37,827,845 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 37,712,262 - 37,827,848 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 43,068,855 - 43,184,449 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 46,429,675 - 46,545,267 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 41,783,170 - 41,898,773 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 40,440,371 - 40,555,178 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 40,440,207 - 40,555,576 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 40,216,307 - 40,331,753 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 40,624,435 - 40,739,692 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 40,624,509 - 40,739,767 (-) NCBI Celera 16 35,834,400 - 35,949,683 (-) NCBI Celera Cytogenetic Map 16 p11 NCBI
VEGFC Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 176,683,538 - 176,792,922 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 176,683,538 - 176,792,922 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 177,604,689 - 177,714,076 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 177,841,685 - 177,950,889 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 177,979,839 - 178,089,044 NCBI Celera 4 174,932,577 - 175,041,751 (-) NCBI Celera Cytogenetic Map 4 q34.3 NCBI HuRef 4 173,355,495 - 173,464,332 (-) NCBI HuRef CHM1_1 4 177,581,139 - 177,690,417 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 180,022,579 - 180,131,932 (-) NCBI T2T-CHM13v2.0
Vegfc Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 54,530,567 - 54,639,489 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 54,530,641 - 54,640,131 (+) Ensembl GRCm39 Ensembl GRCm38 8 54,077,532 - 54,186,454 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 54,077,606 - 54,187,096 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 55,162,886 - 55,271,808 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 55,576,324 - 55,685,149 (+) NCBI MGSCv36 mm8 Celera 8 56,790,779 - 56,893,425 (+) NCBI Celera Cytogenetic Map 8 B1.3 NCBI cM Map 8 29.2 NCBI
Vegfc Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955403 31,016,423 - 31,130,892 (+) NCBI ChiLan1.0 ChiLan1.0
VEGFC Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 174,404,689 - 174,551,470 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 174,784,868 - 174,914,832 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 168,870,941 - 168,999,160 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 181,104,737 - 181,236,024 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 181,104,737 - 181,236,030 (-) Ensembl panpan1.1 panPan2
VEGFC Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 52,883,242 - 52,987,684 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 52,883,139 - 52,987,563 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 48,384,891 - 48,489,160 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 55,195,930 - 55,300,949 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 55,195,409 - 55,300,821 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 53,090,819 - 53,195,148 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 53,687,065 - 53,791,871 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 53,925,224 - 54,029,839 (+) NCBI UU_Cfam_GSD_1.0
Vegfc Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 26,803,257 - 26,918,269 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936516 7,217,543 - 7,332,559 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936516 7,217,543 - 7,332,531 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
VEGFC Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 39,039,311 - 39,132,936 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 39,037,764 - 39,136,234 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 44,742,834 - 44,773,339 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
VEGFC Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 122,772,539 - 122,893,486 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 122,772,182 - 122,893,512 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 102,869,061 - 102,989,877 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Vegfc
.
Assembly: RGSC_v3.4 Assembly: Rnor_5.0
Predicted Target Of
Count of predictions: 195 Count of miRNA genes: 142 Interacting mature miRNAs: 157 Transcripts: ENSRNOT00000015529 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 1578768 Stresp22 Stress response QTL 22 2.8 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 16 35288870 80288870 Rat 2302057 Pia29 Pristane induced arthritis QTL 29 3.6 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 16 21735975 66735975 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 6903294 Stl30 Serum triglyceride level QTL 30 2.6 0.0013 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 16 25152793 70152793 Rat 2293690 Bss45 Bone structure and strength QTL 45 5.13 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 16 37752156 82752156 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 2300163 Bmd64 Bone mineral density QTL 64 5.3 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 16 37752156 82752156 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 8694453 Bw172 Body weight QTL 172 8.33 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 16 24325513 69325513 Rat 1298529 Arunc1 Aerobic running capacity QTL 1 4 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 31951520 60148445 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
D16Rat118
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 16 44,498,650 - 44,498,873 (+) Marker Load Pipeline mRatBN7.2 16 37,765,608 - 37,765,831 (+) MAPPER mRatBN7.2 Rnor_6.0 16 40,492,300 - 40,492,522 NCBI Rnor6.0 Rnor_5.0 16 40,268,236 - 40,268,458 UniSTS Rnor5.0 RGSC_v3.4 16 40,677,635 - 40,677,858 RGD RGSC3.4 RGSC_v3.4 16 40,677,636 - 40,677,858 UniSTS RGSC3.4 RGSC_v3.1 16 40,677,710 - 40,677,933 RGD Celera 16 35,887,600 - 35,887,830 UniSTS SHRSP x BN Map 16 12.43 UniSTS SHRSP x BN Map 16 12.43 RGD Cytogenetic Map 16 p11 UniSTS
AW228853
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 37,712,422 - 37,712,518 (+) MAPPER mRatBN7.2 Rnor_6.0 16 40,440,386 - 40,440,481 NCBI Rnor6.0 Rnor_5.0 16 40,216,322 - 40,216,417 UniSTS Rnor5.0 RGSC_v3.4 16 40,624,450 - 40,624,545 UniSTS RGSC3.4 Celera 16 35,834,415 - 35,834,510 UniSTS Cytogenetic Map 16 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015529 ⟹ ENSRNOP00000015529
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 37,712,262 - 37,827,848 (-) Ensembl Rnor_6.0 Ensembl 16 40,440,207 - 40,555,576 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119624 ⟹ ENSRNOP00000091258
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 37,720,140 - 37,827,848 (-) Ensembl
RefSeq Acc Id:
NM_053653 ⟹ NP_446105
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 44,445,293 - 44,560,887 (-) NCBI mRatBN7.2 16 37,712,251 - 37,827,845 (-) NCBI Rnor_6.0 16 40,440,371 - 40,555,178 (-) NCBI Rnor_5.0 16 40,216,307 - 40,331,753 (-) NCBI RGSC_v3.4 16 40,624,435 - 40,739,692 (-) RGD Celera 16 35,834,400 - 35,949,683 (-) RGD
Sequence:
GGGACTGGGACGAGGAGCGGACCTCAGCCTCGCACCCCAGCCTGCGCCTGCCATCGGACCGGCCTCCTCGCTCCCGGTCCATCCACCATGCACTTGCTGTGCTTCTTGTCTCTGGCGTGTTCCTTGCT
hide sequence
RefSeq Acc Id:
NP_446105 ⟸ NM_053653
- Peptide Label:
precursor
- UniProtKB:
Q91ZE3 (UniProtKB/Swiss-Prot), O35757 (UniProtKB/Swiss-Prot), A6JPH8 (UniProtKB/TrEMBL)
- Sequence:
MHLLCFLSLACSLLAAALIPGPREAPATVAAFESGLGFSEAEPDGGEVKGFEGKDLEEQLRSVSSVDELMSVLYPDYWKMYKCQLRKGGWQQPSLNMRTGDTVKLAAAHYNTEILKSIDNEWRKTQCM
hide sequence
Ensembl Acc Id:
ENSRNOP00000015529 ⟸ ENSRNOT00000015529
Ensembl Acc Id:
ENSRNOP00000091258 ⟸ ENSRNOT00000119624
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Vegfc
vascular endothelial growth factor C
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Vegfc
vascular endothelial growth factor C
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_physical_interaction
can bind and activate VEGFR-3 receptors
727326
gene_product
member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family
727326
