Symbol:
Lbp
Name:
lipopolysaccharide binding protein
RGD ID:
61865
Description:
Enables lipopolysaccharide binding activity. Involved in several processes, including positive regulation of macrophage activation; positive regulation of phagocytosis, engulfment; and response to ethanol. Located in extracellular space. Used to study obesity. Biomarker of liver cirrhosis; metabolic dysfunction and alcohol associated liver disease; obstructive jaundice; and periodontitis. Orthologous to human LBP (lipopolysaccharide binding protein); PARTICIPATES IN interleukin-6 signaling pathway; Toll-like receptor signaling pathway; tuberculosis pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
BPI fold containing family D, member 2; Bpifd2; lipopolysaccharide-binding protein; MGC124626
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LBP (lipopolysaccharide binding protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Lbp (lipopolysaccharide binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LBP (lipopolysaccharide binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LBP (lipopolysaccharide binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lbp (lipopolysaccharide binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LBP (lipopolysaccharide binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LBP (lipopolysaccharide binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lbp (lipopolysaccharide binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
BPI (bactericidal permeability increasing protein) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Lbp (lipopolysaccharide binding protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
LBP (lipopolysaccharide binding protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bpifcl (BPI fold containing family C, like)
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
F01G10.10
Alliance
DIOPT (Hieranoid|OMA|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
C06G1.1
Alliance
DIOPT (OrthoFinder|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
T19C3.5
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
C05C9.1
Alliance
DIOPT (OMA|OrthoFinder|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
F10D11.6
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
bpi4
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 167,373,786 - 167,400,941 (+) NCBI GRCr8 mRatBN7.2 3 146,953,889 - 146,981,032 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 146,954,015 - 146,981,586 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 150,786,436 - 150,813,463 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 159,285,723 - 159,312,752 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 157,020,490 - 157,047,489 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 154,786,232 - 154,812,910 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 154,786,215 - 154,813,464 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 160,793,301 - 160,819,979 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 149,016,605 - 149,043,530 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 148,922,500 - 148,949,992 (+) NCBI Celera 3 145,655,280 - 145,682,077 (+) NCBI Celera Cytogenetic Map 3 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lbp Rat 1,1-dichloroethene increases expression ISO Lbp (Mus musculus) 6480464 vinylidene chloride results in increased expression of LBP mRNA CTD PMID:26682919 Lbp Rat 1,2-dichloroethane increases expression ISO Lbp (Mus musculus) 6480464 ethylene dichloride results in increased expression of LBP mRNA CTD PMID:28189721 and PMID:28960355 Lbp Rat 1,2-dimethylhydrazine increases expression ISO Lbp (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of LBP mRNA CTD PMID:22206623 Lbp Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of LBP mRNA CTD PMID:17522070 more ... Lbp Rat 1-naphthyl isothiocyanate increases expression ISO Lbp (Mus musculus) 6480464 1-Naphthylisothiocyanate results in increased expression of LBP mRNA CTD PMID:15913567 Lbp Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of LBP mRNA CTD PMID:15834898 Lbp Rat 17beta-estradiol decreases expression ISO LBP (Homo sapiens) 6480464 Estradiol results in decreased expression of LBP mRNA CTD PMID:20106945 Lbp Rat 17beta-estradiol increases expression ISO Lbp (Mus musculus) 6480464 Estradiol results in increased expression of LBP mRNA CTD PMID:39298647 Lbp Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of LBP mRNA CTD PMID:32145629 Lbp Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of LBP mRNA CTD PMID:32741896 Lbp Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of LBP mRNA CTD PMID:32741896 Lbp Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO LBP (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Lbp Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Lbp (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in decreased expression of LBP mRNA CTD PMID:16214954 Lbp Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of LBP mRNA CTD PMID:34747641 Lbp Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Lbp (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of LBP mRNA CTD PMID:21570461 and PMID:26377647 Lbp Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of LBP mRNA CTD PMID:19692669 and PMID:20959002 Lbp Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Lbp (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of LBP mRNA CTD PMID:15591033 Lbp Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Lbp (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of LBP mRNA CTD PMID:18796159 more ... Lbp Rat 2,4,6-tribromophenol increases expression ISO LBP (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Lbp Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions ISO Lbp (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of LBP mRNA] CTD PMID:18200517 Lbp Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Lbp (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of LBP mRNA CTD PMID:18200517 Lbp Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of LBP mRNA CTD PMID:21346803 Lbp Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of LBP mRNA CTD PMID:21346803 Lbp Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:19692669 and PMID:20959002 Lbp Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Lbp Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO LBP (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of LBP mRNA and tetrabromobisphenol A results in increased expression of LBP protein CTD PMID:25461914 and PMID:31675489 Lbp Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Lbp (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of LBP mRNA CTD PMID:16054899 Lbp Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO LBP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of LBP mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of LBP mRNA CTD PMID:28628672 Lbp Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of LBP mRNA CTD PMID:25380136 Lbp Rat 4,4'-diaminodiphenylmethane increases expression ISO Lbp (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of LBP mRNA CTD PMID:18648102 Lbp Rat 4,4'-sulfonyldiphenol increases expression ISO LBP (Homo sapiens) 6480464 bisphenol S results in increased expression of LBP mRNA CTD PMID:27685785 Lbp Rat 4,4'-sulfonyldiphenol affects expression ISO Lbp (Mus musculus) 6480464 bisphenol S affects the expression of LBP mRNA CTD PMID:39298647 Lbp Rat 4,4'-sulfonyldiphenol increases expression ISO Lbp (Mus musculus) 6480464 bisphenol S results in increased expression of LBP mRNA CTD PMID:30951980 Lbp Rat 4,4'-sulfonyldiphenol multiple interactions ISO LBP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of LBP mRNA CTD PMID:28628672 Lbp Rat 4-hydroxyphenyl retinamide increases expression ISO Lbp (Mus musculus) 6480464 Fenretinide results in increased expression of LBP mRNA CTD PMID:28973697 Lbp Rat 4-hydroxyphenyl retinamide decreases expression ISO Lbp (Mus musculus) 6480464 Fenretinide results in decreased expression of LBP mRNA CTD PMID:28973697 Lbp Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of LBP mRNA CTD PMID:30047161 Lbp Rat 6-propyl-2-thiouracil multiple interactions ISO Lbp (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of LBP mRNA CTD PMID:36706583 Lbp Rat acrylamide decreases expression ISO Lbp (Mus musculus) 6480464 Acrylamide results in decreased expression of LBP mRNA CTD PMID:35032568 Lbp Rat aflatoxin B1 decreases expression ISO Lbp (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of LBP mRNA CTD PMID:19770486 Lbp Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of LBP mRNA CTD PMID:16309824 Lbp Rat alpha-amanitin affects expression ISO Lbp (Mus musculus) 6480464 Alpha-Amanitin affects the expression of LBP mRNA CTD PMID:38531469 Lbp Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of LBP mRNA CTD PMID:35163327 Lbp Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of LBP mRNA CTD PMID:30047161 Lbp Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of LBP mRNA CTD PMID:16483693 Lbp Rat antirheumatic drug decreases expression ISO LBP (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of LBP mRNA CTD PMID:24449571 Lbp Rat aristolochic acids increases expression EXP 6480464 Aristolochic Acids results in increased expression of LBP mRNA CTD PMID:19717638 Lbp Rat arsenite(3-) multiple interactions ISO Lbp (Mus musculus) 6480464 [Arsenic Trioxide results in increased abundance of arsenite] which results in increased expression of LBP protein and TRP53 protein affects the reaction [arsenite results in decreased expression of LBP mRNA] CTD PMID:18929588 and PMID:36791901 Lbp Rat arsenite(3-) decreases expression ISO Lbp (Mus musculus) 6480464 arsenite results in decreased expression of LBP mRNA CTD PMID:18929588 Lbp Rat arsenous acid multiple interactions ISO Lbp (Mus musculus) 6480464 [Arsenic Trioxide results in increased abundance of arsenite] which results in increased expression of LBP protein CTD PMID:36791901 Lbp Rat atazanavir sulfate multiple interactions ISO LBP (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in decreased expression of LBP mRNA CTD PMID:33819548 Lbp Rat benzo[a]pyrene decreases expression ISO LBP (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of LBP mRNA CTD PMID:20106945 and PMID:32234424 Lbp Rat benzo[a]pyrene affects methylation ISO LBP (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of LBP promoter CTD PMID:27901495 Lbp Rat benzo[a]pyrene increases methylation ISO LBP (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of LBP 3' UTR CTD PMID:27901495 Lbp Rat benzo[a]pyrene increases expression ISO Lbp (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of LBP mRNA CTD PMID:27195522 Lbp Rat benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with 1 more ... CTD PMID:18711122 Lbp Rat benzo[a]pyrene decreases expression ISO Lbp (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of LBP mRNA CTD PMID:19770486 Lbp Rat benzylpenicillin multiple interactions ISO Lbp (Mus musculus) 6480464 [Penicillin G co-treated with Erythromycin] results in increased expression of LBP mRNA CTD PMID:27503388 Lbp Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of LBP mRNA CTD PMID:18164116 Lbp Rat bis(2-chloroethyl) sulfide increases expression ISO Lbp (Mus musculus) 6480464 Mustard Gas results in increased expression of LBP mRNA CTD PMID:18955075 Lbp Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of LBP mRNA CTD PMID:17010207 Lbp Rat bisphenol A decreases expression ISO LBP (Homo sapiens) 6480464 bisphenol A results in decreased expression of LBP protein CTD PMID:31675489 Lbp Rat bisphenol A decreases methylation ISO LBP (Homo sapiens) 6480464 bisphenol A results in decreased methylation of LBP gene CTD PMID:31601247 Lbp Rat bisphenol A multiple interactions ISO LBP (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of LBP gene CTD PMID:31601247 Lbp Rat bisphenol A increases methylation ISO Lbp (Mus musculus) 6480464 bisphenol A results in increased methylation of LBP promoter CTD PMID:27312807 Lbp Rat bisphenol A increases expression ISO LBP (Homo sapiens) 6480464 bisphenol A results in increased expression of LBP mRNA CTD PMID:27685785 Lbp Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LBP mRNA CTD PMID:25181051 more ... Lbp Rat bisphenol A increases expression ISO Lbp (Mus musculus) 6480464 bisphenol A results in increased expression of LBP mRNA CTD PMID:26063408 more ... Lbp Rat bisphenol F increases expression ISO Lbp (Mus musculus) 6480464 bisphenol F results in increased expression of LBP mRNA CTD PMID:30951980 Lbp Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of LBP mRNA CTD PMID:24136188 Lbp Rat butanal decreases expression ISO LBP (Homo sapiens) 6480464 butyraldehyde results in decreased expression of LBP mRNA CTD PMID:26079696 Lbp Rat cadmium atom affects binding ISO LBP (Homo sapiens) 6480464 LBP protein binds to Cadmium CTD PMID:23896426 Lbp Rat cadmium atom multiple interactions ISO Lbp (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of LBP mRNA CTD PMID:37325564 Lbp Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of LBP mRNA CTD PMID:25993096 Lbp Rat cadmium dichloride multiple interactions ISO Lbp (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of LBP mRNA CTD PMID:37325564 Lbp Rat cadmium dichloride increases expression ISO Lbp (Mus musculus) 6480464 Cadmium Chloride results in increased expression of LBP mRNA CTD PMID:26352046 Lbp Rat calcitriol decreases expression ISO LBP (Homo sapiens) 6480464 Calcitriol results in decreased expression of LBP mRNA CTD PMID:26485663 Lbp Rat calcitriol increases expression ISO LBP (Homo sapiens) 6480464 Calcitriol results in increased expression of LBP mRNA CTD PMID:26485663 Lbp Rat carbon nanotube increases expression ISO Lbp (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Lbp Rat carmustine affects response to substance ISO LBP (Homo sapiens) 6480464 LBP mRNA affects the susceptibility to Carmustine CTD PMID:16365179 Lbp Rat CGP 52608 multiple interactions ISO LBP (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to LBP gene] CTD PMID:28238834 Lbp Rat chenodeoxycholic acid multiple interactions ISO LBP (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in decreased expression of LBP mRNA more ... CTD PMID:33819548 Lbp Rat chloroform increases expression EXP 6480464 Chloroform results in increased expression of LBP mRNA CTD PMID:17522070 Lbp Rat ciguatoxin CTX1B affects expression ISO Lbp (Mus musculus) 6480464 Ciguatoxins affects the expression of LBP mRNA CTD PMID:18353800 Lbp Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of LBP protein CTD PMID:24386269 Lbp Rat crocidolite asbestos increases expression ISO Lbp (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of LBP mRNA CTD PMID:23917077 and PMID:29279043 Lbp Rat curcumin multiple interactions ISO Lbp (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of LBP mRNA] CTD PMID:18200517 Lbp Rat cyclosporin A decreases expression ISO LBP (Homo sapiens) 6480464 Cyclosporine results in decreased expression of LBP mRNA CTD PMID:20106945 and PMID:27989131 Lbp Rat cyclosporin A multiple interactions ISO LBP (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Cyclosporine] results in decreased expression of LBP mRNA CTD PMID:33819548 Lbp Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of LBP mRNA CTD PMID:21865292 Lbp Rat cyclosporin A decreases expression ISO Lbp (Mus musculus) 6480464 Cyclosporine results in decreased expression of LBP mRNA CTD PMID:19770486 Lbp Rat decabromodiphenyl ether increases expression ISO LBP (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of LBP protein CTD PMID:31675489 Lbp Rat deoxycholic acid multiple interactions ISO LBP (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in decreased expression of LBP mRNA more ... CTD PMID:33819548 Lbp Rat dexamethasone multiple interactions ISO Lbp (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of LBP mRNA CTD PMID:16054899 Lbp Rat dexamethasone multiple interactions ISO LBP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of LBP mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of LBP mRNA CTD PMID:28628672 Lbp Rat dexamethasone increases expression ISO Lbp (Mus musculus) 6480464 Dexamethasone results in increased expression of LBP mRNA CTD PMID:22733784 Lbp Rat diarsenic trioxide multiple interactions ISO Lbp (Mus musculus) 6480464 [Arsenic Trioxide results in increased abundance of arsenite] which results in increased expression of LBP protein CTD PMID:36791901 Lbp Rat dibenz[a,h]anthracene multiple interactions EXP 6480464 [1 more ... CTD PMID:18711122 Lbp Rat dibenzo[a,l]pyrene multiple interactions EXP 6480464 [1 more ... CTD PMID:18711122 Lbp Rat diclofenac decreases expression ISO Lbp (Mus musculus) 6480464 Diclofenac results in decreased expression of LBP mRNA CTD PMID:26934552 Lbp Rat diclofenac affects expression ISO Lbp (Mus musculus) 6480464 Diclofenac affects the expression of LBP mRNA CTD PMID:26934552 Lbp Rat diclofenac increases expression ISO Lbp (Mus musculus) 6480464 Diclofenac results in increased expression of LBP protein CTD PMID:26934552 Lbp Rat diethyl phthalate decreases expression EXP 6480464 diethyl phthalate results in decreased expression of LBP mRNA CTD PMID:32341500 Lbp Rat diiodine multiple interactions ISO Lbp (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of LBP mRNA CTD PMID:36706583 Lbp Rat dimethylarsinic acid decreases expression ISO Lbp (Mus musculus) 6480464 Cacodylic Acid results in decreased expression of LBP mRNA CTD PMID:32052077 Lbp Rat doxorubicin affects expression EXP 6480464 Doxorubicin affects the expression of LBP mRNA CTD PMID:12187937 Lbp Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of LBP mRNA CTD PMID:29391264 Lbp Rat epoxiconazole decreases expression ISO Lbp (Mus musculus) 6480464 epoxiconazole results in decreased expression of LBP mRNA CTD PMID:35436446 Lbp Rat erythromycin A multiple interactions ISO Lbp (Mus musculus) 6480464 [Penicillin G co-treated with Erythromycin] results in increased expression of LBP mRNA CTD PMID:27503388 Lbp Rat erythromycin estolate increases expression EXP 6480464 Erythromycin Estolate results in increased expression of LBP mRNA CTD PMID:17522070 Lbp Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of LBP mRNA CTD PMID:16098508 Lbp Rat ethanol increases expression EXP 407424596 ethanol increases expression of Lbp protein in liver RGD Lbp Rat ethanol multiple interactions EXP 407424596 puerarin inhibits the reaction [ethanol increases expression of Lbp protein in liver] RGD Lbp Rat fluoranthene multiple interactions EXP 6480464 [1 more ... CTD PMID:18711122 Lbp Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of LBP mRNA CTD PMID:24136188 Lbp Rat fulvestrant multiple interactions ISO LBP (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of LBP gene CTD PMID:31601247 Lbp Rat furan decreases expression EXP 6480464 furan results in decreased expression of LBP mRNA CTD PMID:25539665 Lbp Rat genistein increases expression EXP 6480464 Genistein results in increased expression of LBP mRNA CTD PMID:17010207 Lbp Rat genistein decreases expression ISO Lbp (Mus musculus) 6480464 Genistein results in decreased expression of LBP mRNA CTD PMID:22553218 and PMID:24967385 Lbp Rat Ginkgolide A multiple interactions ISO Lbp (Mus musculus) 6480464 ginkgolide A inhibits the reaction [Carbon Tetrachloride results in increased expression of LBP protein] CTD PMID:31697926 Lbp Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of LBP mRNA CTD PMID:24136188 Lbp Rat glycochenodeoxycholic acid multiple interactions ISO LBP (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in decreased expression of LBP mRNA more ... CTD PMID:33819548 Lbp Rat glycocholic acid multiple interactions ISO LBP (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in decreased expression of LBP mRNA more ... CTD PMID:33819548 Lbp Rat glycodeoxycholic acid multiple interactions ISO LBP (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in decreased expression of LBP mRNA more ... CTD PMID:33819548 Lbp Rat graphene oxide increases expression ISO Lbp (Mus musculus) 6480464 graphene oxide results in increased expression of LBP mRNA CTD PMID:33227293 Lbp Rat indometacin multiple interactions ISO LBP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of LBP mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of LBP mRNA CTD PMID:28628672 Lbp Rat isoprenaline increases expression ISO Lbp (Mus musculus) 6480464 Isoproterenol results in increased expression of LBP mRNA CTD PMID:20003209 and PMID:21335049 Lbp Rat ketamine multiple interactions ISO LBP (Homo sapiens) 6480464 Ketamine inhibits the reaction [Lipopolysaccharides binds to LBP protein] CTD PMID:19540866 Lbp Rat lead diacetate increases expression ISO Lbp (Mus musculus) 6480464 lead acetate results in increased expression of LBP mRNA CTD PMID:21829687 Lbp Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of LBP mRNA CTD PMID:24136188 Lbp Rat levofloxacin increases expression EXP 6480464 Levofloxacin results in increased expression of LBP mRNA CTD PMID:24136188 Lbp Rat lipopolysaccharide multiple interactions ISO LBP (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:19540866 and PMID:35811015 Lbp Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of LBP mRNA CTD PMID:16309824 Lbp Rat lipopolysaccharide increases expression ISO Lbp (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of LBP mRNA CTD PMID:27339419 Lbp Rat lipopolysaccharide increases expression ISO LBP (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of LBP protein CTD PMID:20699433 Lbp Rat lipopolysaccharide affects binding ISO LBP (Homo sapiens) 6480464 Lipopolysaccharides binds to LBP protein CTD PMID:19540866 and PMID:21261300 Lbp Rat lipopolysaccharide increases response to substance ISO LBP (Homo sapiens) 6480464 LBP polymorphism results in increased susceptibility to Lipopolysaccharides CTD PMID:22167001 Lbp Rat menadione affects expression ISO Lbp (Mus musculus) 6480464 Vitamin K 3 affects the expression of LBP mRNA CTD PMID:20829426 Lbp Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of LBP mRNA CTD PMID:30047161 Lbp Rat methotrexate increases expression EXP 6480464 Methotrexate results in increased expression of LBP mRNA CTD PMID:24136188 Lbp Rat methotrexate increases expression ISO LBP (Homo sapiens) 6480464 Methotrexate results in increased expression of LBP mRNA CTD PMID:17400583 Lbp Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of LBP mRNA CTD PMID:28801915 Lbp Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of LBP mRNA CTD PMID:18164116 Lbp Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of LBP mRNA CTD PMID:17072980 and PMID:25380136 Lbp Rat naloxone increases expression EXP 6480464 Naloxone results in increased expression of LBP mRNA CTD PMID:17522070 Lbp Rat nefazodone multiple interactions ISO LBP (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with nefazodone] results in decreased expression of LBP mRNA CTD PMID:33819548 Lbp Rat nickel atom affects binding ISO LBP (Homo sapiens) 6480464 LBP protein binds to Nickel CTD PMID:23896426 Lbp Rat nickel atom increases expression ISO LBP (Homo sapiens) 6480464 Nickel results in increased expression of LBP mRNA CTD PMID:24768652 and PMID:25583101 Lbp Rat Nonylphenol increases expression EXP 6480464 nonylphenol results in increased expression of LBP mRNA CTD PMID:17010207 Lbp Rat O-methyleugenol decreases expression ISO LBP (Homo sapiens) 6480464 methyleugenol results in decreased expression of LBP mRNA CTD PMID:32234424 Lbp Rat paclitaxel increases expression EXP 6480464 Paclitaxel results in increased expression of LBP mRNA CTD PMID:18754875 Lbp Rat paracetamol increases expression ISO Lbp (Mus musculus) 6480464 Acetaminophen results in increased expression of LBP mRNA CTD PMID:17585979 Lbp Rat paracetamol multiple interactions ISO LBP (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of LBP mRNA CTD PMID:33819548 Lbp Rat paracetamol decreases expression ISO LBP (Homo sapiens) 6480464 Acetaminophen results in decreased expression of LBP mRNA CTD PMID:29067470 Lbp Rat paracetamol increases expression ISO LBP (Homo sapiens) 6480464 Acetaminophen results in increased expression of LBP mRNA CTD PMID:26690555 Lbp Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of LBP mRNA CTD PMID:17522070 Lbp Rat paracetamol increases response to substance ISO Lbp (Mus musculus) 6480464 LBP protein results in increased susceptibility to Acetaminophen CTD PMID:15619225 Lbp Rat paracetamol affects expression ISO Lbp (Mus musculus) 6480464 Acetaminophen affects the expression of LBP mRNA CTD PMID:17562736 Lbp Rat perfluorohexanesulfonic acid increases expression ISO Lbp (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of LBP mRNA CTD PMID:37995155 Lbp Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of LBP mRNA CTD PMID:35163327 Lbp Rat perfluorooctanoic acid affects expression ISO LBP (Homo sapiens) 6480464 perfluorooctanoic acid affects the expression of LBP protein CTD PMID:38537583 Lbp Rat phenacetin increases expression EXP 6480464 Phenacetin results in increased expression of LBP mRNA CTD PMID:17082564 Lbp Rat phenformin increases expression EXP 6480464 Phenformin results in increased expression of LBP mRNA CTD PMID:31324951 Lbp Rat phenobarbital increases expression ISO Lbp (Mus musculus) 6480464 Phenobarbital results in increased expression of LBP mRNA CTD PMID:21335049 Lbp Rat phenylhydrazine increases expression EXP 6480464 phenylhydrazine results in increased expression of LBP mRNA CTD PMID:17082564 Lbp Rat pipoxolan multiple interactions ISO Lbp (Mus musculus) 6480464 pipoxolan inhibits the reaction [lipopolysaccharide and Escherichia coli O111 B4 results in increased expression of LBP protein] CTD PMID:32677756 Lbp Rat pirinixic acid multiple interactions ISO Lbp (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of LBP mRNA CTD PMID:19710929 Lbp Rat pirinixic acid increases expression ISO Lbp (Mus musculus) 6480464 pirinixic acid results in increased expression of LBP mRNA CTD PMID:18301758 more ... Lbp Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of LBP mRNA CTD PMID:19162173 Lbp Rat progesterone increases expression ISO LBP (Homo sapiens) 6480464 Progesterone results in increased expression of LBP mRNA CTD PMID:21540246 Lbp Rat quinidine increases expression EXP 6480464 Quinidine results in increased expression of LBP mRNA CTD PMID:17522070 Lbp Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of LBP mRNA CTD PMID:19228061 Lbp Rat resveratrol multiple interactions ISO LBP (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of LBP mRNA CTD PMID:23557933 Lbp Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of LBP mRNA CTD PMID:28374803 Lbp Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO LBP (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of LBP mRNA CTD PMID:35811015 Lbp Rat senecionine increases expression EXP 6480464 senecionine results in increased expression of LBP mRNA CTD PMID:32419051 Lbp Rat silicon dioxide decreases expression ISO LBP (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of LBP mRNA CTD PMID:25895662 Lbp Rat silicon dioxide increases expression ISO Lbp (Mus musculus) 6480464 Silicon Dioxide results in increased expression of LBP mRNA CTD PMID:23221170 Lbp Rat simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of LBP mRNA CTD PMID:16414398 Lbp Rat sodium arsenite decreases expression ISO Lbp (Mus musculus) 6480464 sodium arsenite results in decreased expression of LBP mRNA CTD PMID:31233874 more ... Lbp Rat sodium arsenite increases expression ISO LBP (Homo sapiens) 6480464 sodium arsenite results in increased expression of LBP mRNA CTD PMID:29301061 Lbp Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of LBP mRNA CTD PMID:25993096 Lbp Rat Soman increases expression EXP 6480464 Soman results in increased expression of LBP mRNA CTD PMID:19281266 Lbp Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of LBP mRNA CTD PMID:30047161 Lbp Rat sulindac multiple interactions EXP 6480464 [Sulindac co-treated with lipopolysaccharide and E coli O55-B5] affects the expression of LBP mRNA CTD PMID:20371263 Lbp Rat Sunset Yellow FCF multiple interactions ISO LBP (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in decreased expression of LBP mRNA CTD PMID:33819548 Lbp Rat tacrolimus hydrate increases expression EXP 6480464 Tacrolimus results in increased expression of LBP mRNA CTD PMID:21865292 Lbp Rat temozolomide affects response to substance ISO LBP (Homo sapiens) 6480464 LBP mRNA affects the susceptibility to temozolomide CTD PMID:16365179 Lbp Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of LBP mRNA CTD PMID:32741896 Lbp Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of LBP mRNA CTD PMID:16239168 and PMID:17522070 Lbp Rat tetrachloromethane multiple interactions ISO Lbp (Mus musculus) 6480464 [PANX1 protein co-treated with Carbon Tetrachloride] affects the expression of LBP mRNA and ginkgolide A inhibits the reaction [Carbon Tetrachloride results in increased expression of LBP protein] CTD PMID:29987408 and PMID:31697926 Lbp Rat tetrachloromethane increases expression ISO Lbp (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of LBP protein CTD PMID:31697926 Lbp Rat tetracycline increases expression EXP 6480464 Tetracycline results in increased expression of LBP mRNA CTD PMID:17522070 Lbp Rat theophylline increases expression EXP 6480464 Theophylline results in increased expression of LBP mRNA CTD PMID:17522070 Lbp Rat tolcapone increases expression EXP 6480464 tolcapone results in increased expression of LBP mRNA CTD PMID:24136188 Lbp Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of LBP mRNA CTD PMID:33387578 Lbp Rat triptonide increases expression ISO Lbp (Mus musculus) 6480464 triptonide results in increased expression of LBP mRNA CTD PMID:33045310 Lbp Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of LBP mRNA CTD PMID:24136188 Lbp Rat valproic acid decreases expression ISO LBP (Homo sapiens) 6480464 Valproic Acid results in decreased expression of LBP mRNA CTD PMID:29154799 Lbp Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of LBP mRNA CTD PMID:23034163 Lbp Rat zinc atom affects binding ISO LBP (Homo sapiens) 6480464 LBP protein binds to Zinc CTD PMID:23896426 Lbp Rat zinc(0) affects binding ISO LBP (Homo sapiens) 6480464 LBP protein binds to Zinc CTD PMID:23896426
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP,ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP,ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP) alpha-amanitin (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acids (EXP) arsenite(3-) (ISO) arsenous acid (ISO) atazanavir sulfate (ISO) benzo[a]pyrene (EXP,ISO) benzylpenicillin (ISO) beta-naphthoflavone (EXP) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buspirone (EXP) butanal (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) carbon nanotube (ISO) carmustine (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) chloroform (EXP) ciguatoxin CTX1B (ISO) cobalt dichloride (EXP) crocidolite asbestos (ISO) curcumin (ISO) cyclosporin A (EXP,ISO) decabromodiphenyl ether (ISO) deoxycholic acid (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (EXP) dibenzo[a,l]pyrene (EXP) diclofenac (ISO) diethyl phthalate (EXP) diiodine (ISO) dimethylarsinic acid (ISO) doxorubicin (EXP) endosulfan (EXP) epoxiconazole (ISO) erythromycin A (ISO) erythromycin estolate (EXP) ethanol (EXP) fluoranthene (EXP) flutamide (EXP) fulvestrant (ISO) furan (EXP) genistein (EXP,ISO) Ginkgolide A (ISO) glafenine (EXP) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) graphene oxide (ISO) indometacin (ISO) isoprenaline (ISO) ketamine (ISO) lead diacetate (ISO) leflunomide (EXP) levofloxacin (EXP) lipopolysaccharide (EXP,ISO) menadione (ISO) methimazole (EXP) methotrexate (EXP,ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) naloxone (EXP) nefazodone (ISO) nickel atom (ISO) Nonylphenol (EXP) O-methyleugenol (ISO) paclitaxel (EXP) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenacetin (EXP) phenformin (EXP) phenobarbital (ISO) phenylhydrazine (EXP) pipoxolan (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) quinidine (EXP) resveratrol (EXP,ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) senecionine (EXP) silicon dioxide (ISO) simvastatin (EXP) sodium arsenite (ISO) sodium dichromate (EXP) Soman (EXP) sulfadimethoxine (EXP) sulindac (EXP) Sunset Yellow FCF (ISO) tacrolimus hydrate (EXP) temozolomide (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) tetracycline (EXP) theophylline (EXP) tolcapone (EXP) trichloroethene (EXP) triptonide (ISO) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO)
Biological Process
acute-phase response (IBA,IEA,ISO) cell surface pattern recognition receptor signaling pathway (IEA,ISO) cellular response to lipopolysaccharide (IEA,ISO,ISS) cellular response to lipoteichoic acid (IEA,ISO) defense response to bacterium (IEA) defense response to Gram-negative bacterium (IBA,IEA,ISO) defense response to Gram-positive bacterium (IBA,IEA,ISO) detection of molecule of bacterial origin (IEA,ISO) immune system process (IEA) innate immune response (IBA,IEA,ISO) leukocyte chemotaxis involved in inflammatory response (IEA,ISO) lipid transport (IEA) lipopolysaccharide transport (IEA,ISO) lipopolysaccharide-mediated signaling pathway (IBA,IEA,ISO) liver development (IEP) macrophage activation involved in immune response (IBA,IEA,ISO,ISS) negative regulation of tumor necrosis factor production (IEA,ISO) neutrophil chemotaxis (IEA,ISO) positive regulation of chemokine production (IEA,ISO) positive regulation of interleukin-6 production (IEA,ISO) positive regulation of interleukin-8 production (IEA,ISO) positive regulation of macrophage activation (IBA,IDA,IEA,ISO) positive regulation of neutrophil chemotaxis (IEA,ISO) positive regulation of phagocytosis, engulfment (IDA) positive regulation of respiratory burst involved in inflammatory response (IEA,ISO) positive regulation of toll-like receptor 4 signaling pathway (IEA,ISO) positive regulation of tumor necrosis factor production (IEA,ISO,ISS) regulation of membrane permeability (IMP) response to ethanol (IEP) response to lipopolysaccharide (IEA,ISO)
1.
Lipopolysaccharide-binding protein and lipopolysaccharide receptor CD14 gene expression after thermal injury and its potential mechanism(s).
Fang CW, etal., J Trauma. 2002 Nov;53(5):957-67.
2.
Serum LBP levels reflect the impaired synthetic capacity of the remnant liver after partial hepatectomy in rats.
Fang H, etal., J Immunol Methods. 2012 Aug 31;382(1-2):68-75. doi: 10.1016/j.jim.2012.05.006. Epub 2012 May 8.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Induction of hepatocyte lipopolysaccharide binding protein in models of sepsis and the acute-phase response.
Geller DA, etal., Arch Surg. 1993 Jan;128(1):22-7; discussion 27-8.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Dietary supplementation of n-3 PUFA reduces weight gain and improves postprandial lipaemia and the associated inflammatory response in the obese JCR:LA-cp rat.
Hassanali Z, etal., Diabetes Obes Metab. 2010 Feb;12(2):139-47. doi: 10.1111/j.1463-1326.2009.01130.x. Epub 2009 Nov 16.
7.
Lipopolysaccharide-binding protein accelerates and augments Escherichia coli phagocytosis by alveolar macrophages.
Klein RD, etal., J Surg Res. 2000 Dec;94(2):159-66.
8.
Postnatal development of hepatic innate immune response.
Le Rouzic V, etal., Inflammation. 2011 Dec;34(6):576-84. doi: 10.1007/s10753-010-9265-5.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
Activity of lipopolysaccharide-binding protein-bactericidal/permeability-increasing protein fusion peptide in an experimental model of Pseudomonas sepsis.
Opal SM, etal., Antimicrob Agents Chemother. 1995 Dec;39(12):2813-5.
12.
Myeloid differentiation 2 as a therapeutic target of inflammatory disorders.
Park SH, etal., Pharmacol Ther. 2012 Mar;133(3):291-8. doi: 10.1016/j.pharmthera.2011.11.001. Epub 2011 Nov 19.
13.
Puerarin ameliorates experimental alcoholic liver injury by inhibition of endotoxin gut leakage, Kupffer cell activation, and endotoxin receptors expression.
Peng JH, etal., J Pharmacol Exp Ther. 2013 Mar;344(3):646-54. doi: 10.1124/jpet.112.201137. Epub 2012 Dec 31.
14.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
15.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
16.
GOA pipeline
RGD automated data pipeline
17.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
Lipopolysaccharide disrupts tight junctions in cholangiocyte monolayers by a c-Src-, TLR4-, and LBP-dependent mechanism.
Sheth P, etal., Am J Physiol Gastrointest Liver Physiol. 2007 Jul;293(1):G308-18. Epub 2007 Apr 19.
20.
Altered gene expression in gingival tissues and enhanced bone loss in rats with diabetes with experimental periodontitis.
Soboku K, etal., J Periodontol. 2014 Mar;85(3):455-64. doi: 10.1902/jop.2013.120705. Epub 2013 Jun 3.
21.
Surfactant protein a inhibits lipopolysaccharide-induced immune cell activation by preventing the interaction of lipopolysaccharide with lipopolysaccharide-binding protein.
Stamme C, etal., Am J Respir Cell Mol Biol 2002 Sep;27(3):353-60.
22.
Kupffer cell activation by lipopolysaccharide in rats: role for lipopolysaccharide binding protein and toll-like receptor 4.
Su GL, etal., Hepatology. 2000 Apr;31(4):932-6.
23.
Molecular cloning, characterization, and tissue distribution of rat lipopolysaccharide binding protein. Evidence for extrahepatic expression.
Su GL, etal., J Immunol 1994 Jul 15;153(2):743-52.
24.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
25.
High-density lipoprotein administration attenuates liver proinflammatory response, restores liver endothelial nitric oxide synthase activity, and lowers portal pressure in cirrhotic rats.
Thabut D, etal., Hepatology. 2007 Dec;46(6):1893-906.
26.
The Kinetic Expression of Lipopolysaccharide-Binding Protein and CD14 Gene in Obstructive Jaundice.
Tsai CH, etal., J Invest Surg. 2014 Aug 5.
27.
Activation of the lipopolysaccharide signaling pathway in hepatic transplantation preservation injury.
Tsoulfas G, etal., Transplantation. 2002 Jul 15;74(1):7-13.
28.
LBP inhibitory peptide reduces endotoxin-induced macrophage activation and mortality.
Wu X, etal., Inflamm Res. 2005 Nov;54(11):451-7.
29.
[Role of endotoxin translocation on mesenteric lymph reperfusion aggravating multiple organ injury in SMAO shock rats].
Yang LN, etal., Zhongguo Ying Yong Sheng Li Xue Za Zhi. 2012 Jan;28(1):74-8.
Lbp Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 167,373,786 - 167,400,941 (+) NCBI GRCr8 mRatBN7.2 3 146,953,889 - 146,981,032 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 146,954,015 - 146,981,586 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 150,786,436 - 150,813,463 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 159,285,723 - 159,312,752 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 157,020,490 - 157,047,489 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 154,786,232 - 154,812,910 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 154,786,215 - 154,813,464 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 160,793,301 - 160,819,979 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 149,016,605 - 149,043,530 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 148,922,500 - 148,949,992 (+) NCBI Celera 3 145,655,280 - 145,682,077 (+) NCBI Celera Cytogenetic Map 3 q42 NCBI
LBP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 38,346,482 - 38,377,013 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 38,346,482 - 38,377,013 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 36,974,885 - 37,005,655 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 36,408,299 - 36,439,067 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 36,408,298 - 36,439,067 NCBI Celera 20 33,683,680 - 33,714,456 (+) NCBI Celera Cytogenetic Map 20 q11.23 NCBI HuRef 20 33,709,729 - 33,740,760 (+) NCBI HuRef CHM1_1 20 36,878,602 - 36,909,384 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 40,072,800 - 40,104,597 (+) NCBI T2T-CHM13v2.0
Lbp Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 158,148,413 - 158,174,772 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 158,148,413 - 158,174,772 (+) Ensembl GRCm39 Ensembl GRCm38 2 158,306,493 - 158,332,852 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 158,306,493 - 158,332,852 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 158,132,229 - 158,158,588 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 157,997,986 - 158,023,737 (+) NCBI MGSCv36 mm8 Celera 2 164,244,570 - 164,269,152 (+) NCBI Celera Cytogenetic Map 2 H1 NCBI cM Map 2 78.72 NCBI
LBP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 44,070,881 - 44,103,778 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 44,063,979 - 44,096,876 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 34,670,128 - 34,703,046 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 35,780,768 - 35,813,188 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 35,780,768 - 35,813,188 (+) Ensembl panpan1.1 panPan2
LBP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 26,810,369 - 26,833,515 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 26,809,843 - 26,833,434 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 26,456,134 - 26,479,256 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 27,506,422 - 27,529,551 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 27,506,460 - 27,529,472 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 26,780,778 - 26,803,800 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 26,888,642 - 26,911,780 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 27,377,130 - 27,400,265 (+) NCBI UU_Cfam_GSD_1.0
Lbp Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 175,713,998 - 175,732,560 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936561 3,016,926 - 3,035,552 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936561 3,017,471 - 3,035,481 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LBP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 41,398,791 - 41,429,551 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 41,398,935 - 41,429,467 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 46,838,042 - 46,868,577 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LBP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 25,375,364 - 25,407,181 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 25,374,755 - 25,406,839 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 74,213,568 - 74,246,762 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lbp
.
Predicted Target Of
Count of predictions: 126 Count of miRNA genes: 94 Interacting mature miRNAs: 107 Transcripts: ENSRNOT00000019787 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12879876 Bw182 Body weight QTL 182 0.003 body mass (VT:0001259) body weight (CMO:0000012) 3 145925360 166177555 Rat 2301411 Bp320 Blood pressure QTL 320 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 145925360 166177555 Rat 2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1300113 Bp176 Blood pressure QTL 176 3.9 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 145956084 157309487 Rat 12879872 Cm97 Cardiac mass QTL 97 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 145925360 166177555 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 12879873 Cm96 Cardiac mass QTL 96 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 145925360 166177555 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 12879874 Cm98 Cardiac mass QTL 98 0.005 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 145925360 166177555 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 12879875 Kidm64 Kidney mass QTL 64 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 145925360 166177555 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 8552791 Vie2 Viral induced encephalitis QTL 2 4.1 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 3 145956084 169034231 Rat 61335 Bp20 Blood pressure QTL 20 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141339236 155617360 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 2317883 Alcrsp26 Alcohol response QTL 26 1.8 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 3 145526770 169034231 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1331726 Bp208 Blood pressure QTL 208 3.129 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 141339013 162184794 Rat 1598854 Memor10 Memory QTL 10 2 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 3 145956084 161299569 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 5686842 Rf59 Renal function QTL 59 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 3 140069424 146976080 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 12879871 Am7 Aortic mass QTL 7 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 145925360 166177555 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
D3Got121
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 167,395,778 - 167,395,989 (+) Marker Load Pipeline mRatBN7.2 3 146,975,869 - 146,976,080 (+) MAPPER mRatBN7.2 Rnor_6.0 3 154,807,748 - 154,807,958 NCBI Rnor6.0 Rnor_5.0 3 160,798,253 - 160,798,463 UniSTS Rnor5.0 RGSC_v3.4 3 149,038,367 - 149,038,578 RGD RGSC3.4 RGSC_v3.4 3 149,038,368 - 149,038,578 UniSTS RGSC3.4 RGSC_v3.1 3 148,944,277 - 148,944,487 RGD Celera 3 145,676,915 - 145,677,125 UniSTS RH 3.4 Map 3 1357.9 UniSTS RH 3.4 Map 3 1357.9 RGD Cytogenetic Map 3 q42 UniSTS
D3Got125
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 146,975,873 - 146,976,091 (+) MAPPER mRatBN7.2 Rnor_6.0 3 154,807,752 - 154,807,969 NCBI Rnor6.0 Rnor_5.0 3 160,798,242 - 160,798,459 UniSTS Rnor5.0 RGSC_v3.4 3 149,038,371 - 149,038,589 RGD RGSC3.4 RGSC_v3.4 3 149,038,372 - 149,038,589 UniSTS RGSC3.4 RGSC_v3.1 3 148,944,281 - 148,944,498 RGD Celera 3 145,676,919 - 145,677,136 UniSTS RH 3.4 Map 3 1357.6 RGD RH 3.4 Map 3 1357.6 UniSTS Cytogenetic Map 3 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
112
91
90
59
25
59
6
218
97
92
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019787 ⟹ ENSRNOP00000019787
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 146,954,015 - 146,981,586 (+) Ensembl Rnor_6.0 Ensembl 3 154,786,215 - 154,813,464 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000096776 ⟹ ENSRNOP00000095950
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 146,954,015 - 146,978,615 (+) Ensembl
RefSeq Acc Id:
NM_017208 ⟹ NP_058904
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 167,373,941 - 167,400,941 (+) NCBI mRatBN7.2 3 146,954,032 - 146,981,032 (+) NCBI Rnor_6.0 3 154,786,232 - 154,812,910 (+) NCBI Rnor_5.0 3 160,793,301 - 160,819,979 (-) NCBI RGSC_v3.4 3 149,016,605 - 149,043,530 (+) RGD Celera 3 145,655,280 - 145,682,077 (+) RGD
Sequence:
CTCACTCACGGAGCATCCAGGATGAAGTCTGCGACTGGGCCTCTGCTTCCTACATTGCTGGGGCTACTGCTCCTGTCTATACCAAGGACTCAGGGTGTCAATCCCGCCATGGTGGTCAGGATCACCGA
hide sequence
RefSeq Acc Id:
XM_039104446 ⟹ XP_038960374
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 167,380,486 - 167,400,936 (+) NCBI mRatBN7.2 3 146,960,578 - 146,981,032 (+) NCBI
RefSeq Acc Id:
XM_039104447 ⟹ XP_038960375
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 167,373,786 - 167,390,903 (+) NCBI mRatBN7.2 3 146,953,889 - 146,970,988 (+) NCBI
RefSeq Acc Id:
XM_039104448 ⟹ XP_038960376
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 167,382,830 - 167,400,936 (+) NCBI mRatBN7.2 3 146,962,939 - 146,981,032 (+) NCBI
RefSeq Acc Id:
NP_058904 ⟸ NM_017208
- Peptide Label:
precursor
- UniProtKB:
Q63313 (UniProtKB/Swiss-Prot), Q3MID7 (UniProtKB/TrEMBL), F7FLI1 (UniProtKB/TrEMBL)
- Sequence:
MKSATGPLLPTLLGLLLLSIPRTQGVNPAMVVRITDKGLEYAAKEGLLSLQRELYKITLPDFSGDFKIKAVGRGQYEFHSLEIQSCQLRGSSLKPLPGRGLSLSISDSSISVRGKWKVRRSFVKLHGS
hide sequence
Ensembl Acc Id:
ENSRNOP00000019787 ⟸ ENSRNOT00000019787
RefSeq Acc Id:
XP_038960375 ⟸ XM_039104447
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038960374 ⟸ XM_039104446
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038960376 ⟸ XM_039104448
- Peptide Label:
isoform X3
Ensembl Acc Id:
ENSRNOP00000095950 ⟸ ENSRNOT00000096776
RGD ID: 13692620 Promoter ID: EPDNEW_R3144 Type: multiple initiation site Name: Lbp_1 Description: lipopolysaccharide binding protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 154,786,219 - 154,786,279 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Lbp
lipopolysaccharide binding protein
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_regulation
interaction with lipopolysaccharide is inhibited by Pulmonary surfactant protein (SP)-A binding to lipopolysaccharide
727417
