Advanced Search (OLGA)

Gene: Rgs9 (regulator of G-protein signaling 9) Rattus norvegicus

Analyze

Symbol:

Rgs9

Name:

regulator of G-protein signaling 9

RGD ID:

3572

Description:

Enables GTPase activator activity. Involved in several processes, including G protein-coupled dopamine receptor signaling pathway; regulation of calcium ion export across plasma membrane; and response to amphetamine. Predicted to be located in membrane. Predicted to be active in several cellular components, including glutamatergic synapse; neuron projection; and synaptic membrane. Biomarker of Parkinsonism. Human ortholog(s) of this gene implicated in bradyopsia 1. Orthologous to human RGS9 (regulator of G protein signaling 9); PARTICIPATES IN dopamine signaling pathway via D1 family of receptors; dopamine signaling pathway via D2 family of receptors; G protein mediated signaling pathway via Galphai family; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3-bis(4-hydroxyphenyl)propionitrile.

Type:

protein-coding

RefSeq Status:

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RGS9 (regulator of G protein signaling 9)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rgs9 (regulator of G-protein signaling 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rgs9 (regulator of G protein signaling 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RGS9 (regulator of G protein signaling 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RGS9 (regulator of G protein signaling 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rgs9 (regulator of G protein signaling 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RGS9 (regulator of G protein signaling 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RGS9 (regulator of G protein signaling 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rgs9 (regulator of G protein signaling 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rgs9 (regulator of G protein signaling 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TRMT10C (tRNA methyltransferase 10C, mitochondrial RNase P subunit)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RGS9 (regulator of G protein signaling 9)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rgs9 (regulator of G-protein signaling 9)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rgs9b (regulator of G protein signaling 9b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rgs9a (regulator of G protein signaling 9a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	eat-16	Alliance	DIOPT (OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	eat-16	Alliance	DIOPT (PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG42450	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	LOC101731116	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	94,696,556 - 94,770,387 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	94,696,556 - 94,770,387 (-)	Ensembl				GRCr8
mRatBN7.2	10	94,195,265 - 94,270,892 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	94,197,054 - 94,270,892 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	99,254,636 - 99,328,487 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	98,717,732 - 98,791,573 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	94,128,846 - 94,202,118 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	97,509,971 - 97,582,188 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	97,509,971 - 97,582,188 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	97,225,541 - 97,298,645 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	98,598,326 - 98,647,948 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	92,858,619 - 92,931,658 (-)	NCBI		Celera
RGSC_v3.1	10	98,612,695 - 98,667,250 (-)	NCBI
Cytogenetic Map	10	q32.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

bradyopsia (ISO)

bradyopsia 1 (ISO)

Drug-Induced Dyskinesia (ISO)

fundus dystrophy (ISO)

genetic disease (ISO)

Hereditary Eye Diseases (ISO)

Leber congenital amaurosis (ISO)

optic atrophy (ISO)

Parkinsonism (IEP,ISO)

retinitis pigmentosa 1 (ISO)

schizophrenia (ISO)

substance-induced psychosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,3-bis(4-hydroxyphenyl)propionitrile (EXP)

2,4,4'-trichlorobiphenyl (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

amitrole (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

apomorphine (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (EXP)

atrazine (EXP,ISO)

benzo[a]pyrene (EXP,ISO)

benzo[b]fluoranthene (ISO)

benzo[e]pyrene (ISO)

Benzo[k]fluoranthene (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

Butylbenzyl phthalate (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

cordycepin (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

ethanol (ISO)

genistein (ISO)

haloperidol (ISO)

hydralazine (ISO)

ketamine (EXP)

lipopolysaccharide (ISO)

methapyrilene (ISO)

methimazole (EXP)

Moniliformin (ISO)

N-methyl-4-phenylpyridinium (EXP)

nickel sulfate (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (EXP)

PCB138 (ISO)

pentanal (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

propanal (ISO)

quinpirole (ISO)

reserpine (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sulfadimethoxine (EXP)

tamoxifen (ISO)

tetraphene (ISO)

trichloroethene (EXP)

triclosan (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

dark adaptation (ISO)

G protein-coupled dopamine receptor signaling pathway (IBA,IMP)

G protein-coupled receptor signaling pathway (IEA)

intracellular signal transduction (IEA)

light adaption (ISO)

negative regulation of NMDA glutamate receptor activity (IDA)

negative regulation of signal transduction (IEA)

nervous system development (IEP)

regulation of calcium ion export across plasma membrane (IDA)

regulation of G protein-coupled receptor signaling pathway (IDA,IEA)

regulation of monoatomic cation transmembrane transport (IEA)

response to amphetamine (IEP)

response to estradiol (IEP)

visual perception (IEA)

Cellular Component

cytoplasm (IBA)

glutamatergic synapse (IEA,ISO)

membrane (IEA)

neuron projection (IBA)

photoreceptor inner segment (ISO)

photoreceptor outer segment (ISO)

plasma membrane (IBA)

postsynaptic density membrane (IEA,ISO)

presynaptic membrane (IEA,ISO)

Molecular Function

GTPase activator activity (IBA,IDA,IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

dopamine signaling pathway via D1 family of receptors (ISO)

dopamine signaling pathway via D2 family of receptors (ISO)

G protein mediated signaling pathway via Galphai family (ISO)

G protein mediated signaling pathway via Galphas family (ISO)

visual phototransduction pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Photoreceptor signaling: supporting vision across a wide range of light intensities.	Arshavsky VY and Burns ME, J Biol Chem. 2012 Jan 13;287(3):1620-6. Epub 2011 Nov 10.
2.	The physiology, signaling, and pharmacology of dopamine receptors.	Beaulieu JM and Gainetdinov RR, Pharmacol Rev. 2011 Mar;63(1):182-217. doi: 10.1124/pr.110.002642. Epub 2011 Feb 8.
3.	Brain-specific RGS9-2 is localized to the nucleus via its unique proline-rich domain.	Bouhamdan M, etal., Biochim Biophys Acta. 2004 May 3;1691(2-3):141-50.
4.	Brain-specific regulator of G-protein signaling 9-2 selectively interacts with alpha-actinin-2 to regulate calcium-dependent inactivation of NMDA receptors.	Bouhamdan M, etal., J Neurosci. 2006 Mar 1;26(9):2522-30.
5.	RGS9-2 modulates D2 dopamine receptor-mediated Ca2+ channel inhibition in rat striatal cholinergic interneurons.	Cabrera-Vera TM, etal., Proc Natl Acad Sci U S A. 2004 Nov 16;101(46):16339-44. Epub 2004 Nov 8.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	RGS9-2 negatively modulates L-3,4-dihydroxyphenylalanine-induced dyskinesia in experimental Parkinson's disease.	Gold SJ, etal., J Neurosci. 2007 Dec 26;27(52):14338-48. doi: 10.1523/JNEUROSCI.4223-07.2007.
9.	Molecular characterization of human and rat RGS 9L, a novel splice variant enriched in dopamine target regions, and chromosomal localization of the RGS 9 gene.	Granneman JG, etal., Mol Pharmacol 1998 Oct;54(4):687-94.
10.	Differential expression of the regulator of G protein signaling RGS9 protein in nociceptive pathways of different age rats.	Kim KJ, etal., Brain Res Dev Brain Res. 2005 Nov 7;160(1):28-39. Epub 2005 Sep 8.
11.	EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins.	Koelle MR and Horvitz HR, Cell 1996 Jan 12;84(1):115-25.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	Defects in RGS9 or its anchor protein R9AP in patients with slow photoreceptor deactivation.	Nishiguchi KM, etal., Nature. 2004 Jan 1;427(6969):75-8.
15.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
16.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
17.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	Estrogen modulates RGS9 expression in the nucleus accumbens.	Sharifi JL, etal., Neuroreport. 2004 Oct 25;15(15):2433-6.
20.	The brain gene expression profile of dopamine D2/D3 receptors and associated signaling proteins following amphetamine self-administration.	Sun H, etal., Neuroscience. 2015 Oct 29;307:253-61. doi: 10.1016/j.neuroscience.2015.08.053. Epub 2015 Aug 28.
21.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
22.	The involvement of RGS9 in l-3,4-dihydroxyphenylalanine-induced dyskinesias in unilateral 6-OHDA lesion rat model.	Yin LL, etal., Brain Res Bull. 2011 Nov 25;86(5-6):367-72. doi: 10.1016/j.brainresbull.2011.09.016. Epub 2011 Sep 24.
23.	Decreased RGS9 protein level in the striatum of rodents undergoing MPTP or 6-OHDA neurotoxicity.	Yin LL, etal., Neurosci Lett. 2010 Aug 2;479(3):231-5. doi: 10.1016/j.neulet.2010.05.068. Epub 2010 Jun 1.

Additional References at PubMed

PMID:9556034	PMID:12818179	PMID:14595021	PMID:17493623	PMID:17970732	PMID:18094251	PMID:22132185	PMID:23555598

Genomics

Comparative Map Data

Rgs9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	94,696,556 - 94,770,387 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	94,696,556 - 94,770,387 (-)	Ensembl				GRCr8
mRatBN7.2	10	94,195,265 - 94,270,892 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	94,197,054 - 94,270,892 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	99,254,636 - 99,328,487 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	98,717,732 - 98,791,573 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	94,128,846 - 94,202,118 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	97,509,971 - 97,582,188 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	97,509,971 - 97,582,188 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	97,225,541 - 97,298,645 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	98,598,326 - 98,647,948 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	92,858,619 - 92,931,658 (-)	NCBI		Celera
RGSC_v3.1	10	98,612,695 - 98,667,250 (-)	NCBI
Cytogenetic Map	10	q32.1	NCBI

RGS9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	65,137,370 - 65,227,703 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	65,100,812 - 65,227,703 (+)	Ensembl			hg38	GRCh38
GRCh37	17	63,133,488 - 63,223,821 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	60,564,011 - 60,654,283 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	17	60,615,283 - 60,654,266	NCBI
Celera	17	59,704,785 - 59,795,215 (+)	NCBI		Celera
Cytogenetic Map	17	q24.1	NCBI
HuRef	17	58,525,814 - 58,616,238 (+)	NCBI		HuRef
CHM1_1	17	63,197,767 - 63,288,180 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	66,007,344 - 66,097,756 (+)	NCBI		T2T-CHM13v2.0

Rgs9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	109,116,174 - 109,189,013 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	109,116,181 - 109,188,955 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	109,225,348 - 109,298,181 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	109,225,355 - 109,298,129 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	109,086,669 - 109,159,495 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	109,041,445 - 109,114,219 (-)	NCBI		MGSCv36	mm8
Celera	11	120,960,687 - 121,033,676 (-)	NCBI		Celera
Cytogenetic Map	11	E1	NCBI
cM Map	11	71.86	NCBI

Rgs9
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955478	4,614,701 - 4,683,167 (+)	Ensembl
ChiLan1.0	NW_004955478	4,614,730 - 4,683,152 (+)	NCBI	ChiLan1.0	ChiLan1.0

RGS9
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	81,178,480 - 81,269,062 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	85,997,370 - 86,088,043 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	59,085,707 - 59,176,368 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	64,298,830 - 64,389,559 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	64,262,585 - 64,389,559 (+)	Ensembl			panPan2	panpan1.1

RGS9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	14,809,977 - 14,905,299 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	14,809,864 - 14,905,197 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	15,702,914 - 15,771,584 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	16,472,893 - 16,541,456 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	16,472,820 - 16,568,043 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	15,418,110 - 15,486,557 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	12,046,837 - 12,115,342 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	12,047,442 - 12,116,459 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rgs9
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	11,669,409 - 11,736,336 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936541	7,458,539 - 7,525,220 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936541	7,472,195 - 7,525,220 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RGS9
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	12,015,321 - 12,087,976 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	12,015,321 - 12,087,982 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	12,484,168 - 12,513,644 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RGS9
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	56,199,051 - 56,291,002 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	56,199,343 - 56,288,290 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666077	26,797,684 - 26,891,195 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rgs9
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624870	3,143,950 - 3,218,117 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624870	3,138,311 - 3,249,297 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rgs9
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	69,841,032 - 69,913,802 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rgs9
890 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	33
Count of miRNA genes:	33
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000005076
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	51071897	96071897	Rat
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93723381	107556066	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	58073360	103073360	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90904245	95604677	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	54296336	99451733	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76951790	107713808	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50464802	95464802	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	79272424	102982300	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	73599825	107713808	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45529164	96099749	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
10450495	Bp383	Blood pressure QTL 383		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76743133	95464802	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50860288	95860288	Rat
2313856	Bp342	Blood pressure QTL 342	4.4	0.0001	life span trait (VT:0005372)	age at time of death (CMO:0001193)	10	87807758	96620484	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2292617	Ept18	Estrogen-induced pituitary tumorigenesis QTL 18	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73950353	96620293	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87807758	107713808	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	67241334	98502431	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	91127270	95604677	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61843496	98710773	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	91127270	107556066	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	73695339	97272278	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	81012077	101828297	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90904245	95604677	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90904245	95604677	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90904245	95604677	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90904245	95604677	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90904245	95604677	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68920187	107713808	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	89039175	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	88900501	96620484	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70698731	107713808	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61843496	100198886	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49943710	94943710	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61843496	100198886	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
12880055	Am11	Aortic mass QTL 11		0.004	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	84503487	96432422	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76743133	95604677	Rat
2301398	Kidm38	Kidney mass QTL 38		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	84503487	96432422	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50604677	95604677	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	76128947	107713808	Rat
1358188	Ept9	Estrogen-induced pituitary tumorigenesis QTL 9	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73950353	96620293	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91727883	107713808	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

RH139432

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	94,201,563 - 94,201,725 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	97,514,481 - 97,514,642	NCBI	Rnor6.0
Rnor_5.0	10	97,230,051 - 97,230,212	UniSTS	Rnor5.0
RGSC_v3.4	10	98,602,836 - 98,602,997	UniSTS	RGSC3.4
Celera	10	92,863,129 - 92,863,290	UniSTS
RH 3.4 Map	10	1071.59	UniSTS
Cytogenetic Map	10	q32.1	UniSTS

BE119038

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	94,200,574 - 94,200,754 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	97,513,492 - 97,513,671	NCBI	Rnor6.0
Rnor_5.0	10	97,229,062 - 97,229,241	UniSTS	Rnor5.0
RGSC_v3.4	10	98,601,847 - 98,602,026	UniSTS	RGSC3.4
Celera	10	92,862,140 - 92,862,319	UniSTS
RH 3.4 Map	10	1074.9	UniSTS
Cytogenetic Map	10	q32.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	4	47	162	78	77	46	86	46	6	308	163	11	140	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019224	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB019145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF038006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF071475	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	PQ336708	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U32433	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005076 ⟹ ENSRNOP00000005076

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	94,696,556 - 94,770,387 (-)	Ensembl
mRatBN7.2 Ensembl	10	94,197,054 - 94,270,892 (-)	Ensembl
Rnor_6.0 Ensembl	10	97,509,971 - 97,582,188 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096063 ⟹ ENSRNOP00000082141

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	94,731,042 - 94,770,387 (-)	Ensembl
mRatBN7.2 Ensembl	10	94,231,180 - 94,270,892 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105087 ⟹ ENSRNOP00000079708

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	94,696,556 - 94,770,387 (-)	Ensembl
mRatBN7.2 Ensembl	10	94,197,054 - 94,270,892 (-)	Ensembl

RefSeq Acc Id:

NM_019224 ⟹ NP_062097

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	94,696,556 - 94,770,387 (-)	NCBI
mRatBN7.2	10	94,197,054 - 94,270,892 (-)	NCBI
Rnor_6.0	10	97,509,971 - 97,582,188 (-)	NCBI
Rnor_5.0	10	97,225,541 - 97,298,645 (-)	NCBI
RGSC_v3.4	10	98,598,326 - 98,647,948 (-)	RGD
Celera	10	92,858,619 - 92,931,658 (-)	RGD

Sequence:

show sequence

TCCTCTTTCCGTGCCTCCCAGTCCACGCCCAGGCTGGGGCGGACCAGGCTGGCTGGTGAACTTG
GGGGTTTCCCCTTTTCGCTCCCATTCGTGCTGTGGTCGTGAATTCATCCAGGGTCCAGAATGAC
GATCCGACACCAAGGCCAGCAGTACAGGCCGAGGATGGCATTTCTTCAAAAGATTGAAGCACTC
GTGAAGGACATGCAGAACCCAGAGACGGGAGTCAGAATGCAGAACCAGAGAGTCTTGGTCACCA
GTGTCCCTCATGCCATGACAGGAGGCGATGTTCTGCAATGGATCATCCAGCGCCTTTGGATCTC
TAACCTCGAGGCGCAGAACTTGGGTAACTTCATCGTCAAGTACGGCTACATCTACCCTTTGCAA
GACCCGAAGAATCTCGTCCTCAAACCTGACAGCAGCCTCTATCGATTTCAGACGCCGTACTTCT
GGCCCACTCAGCAGTGGCCAGCTGAGGACACCGACTATGCCATCTATCTAGCTAAGCGAAATAT
CAAGAAGAAGGGGATTTTAGAAGAATATGAAAAGGAAAACTATGATTTCTTGAACAAGAAGATT
AATTACAAGTGGGATTTTGTCATCATGCAGGCCAAGGAGCAGTACCGGACTGGAAAGGAGAGGA
ACAAAGCTGACAGGTATGCGCTGGATTGCCAGGAGAAGGCGTATTGGCTGGTGCACCGAAGCCC
TCCTGGAATGAACAATGTGTTAGACTACGGCCTGGACCGCGTGACCAATCCAAACGAAGTTAAG
AAACAAACAGTCACTGCTGTCAGAAAGGAGATTATGTATTACCAGCAGGCCTTAATGAGGTCCA
CAGTGAAGTCTTCGGTGTCCCTTGGAGGAATCGTCAAGTATAGTGAGCAGTTCTCGTCCAATGA
TGCCATCATGTCTGGCTGCCTTCCAAGTAATCCTTGGATCACAGACGACACCCAGTTCTGGGAT
TTAAACGCCAAGTTGGTGGAGGTCCCAACCAAGATGCGGGTGGAGAGATGGGCTTTCAACTTCA
GCGAACTGATTCGAGACCCCAAGGGCCGGCAGAGCTTCCAGTACTTTCTCAAGAAGGAATTCAG
TGGGGAGAACCTGGGATTCTGGGAAGCCTGTGAGGATCTGAAGTATGGGGATCAGTCCAAGGTC
AAGGAGAAGGCAGAGGAGATCTACAAGCTGTTCCTGGCACCGGGTGCAAGGCGATGGATCAACA
TAGACGGCAAAACCATGGACATCACCGTGAAGGGGCTGAGACACCCCCACCGCTATGTGTTGGA
CGCGGCGCAGACCCACATTTACATGCTCATGAAGAAGGATTCTTATGCTCGCTATTTGAAATCT
CCGATCTATAAAGAAATGCTGGCCAAAGCTATCGAGCCACAGGAAACCACCAAGAGAAGCTCCA
CCCTCCCATTTATGAGACGCCACCTACGCTCCAGCCCAAGCCCTGTCATTCTGCGGCAGCTGGA
AGAAGAAGAGAGAGCTCGAGAAGCAGCCAACACCGTGGACATCACCCAGCCAGGTCAGCACTTG
GCTCCCAGCCCTCACCTGGCCGTGTACACAGGGACCTGCGTGCCTCCCTCTCCCTCCAGCCCCT
TCTCACCATCCTGCCGCTCGCCCAGGAAGCCCTTCCCTTCCCCAAGTCGCTTCATCCGGCGGCC
CAGCATTGCCATCTGCCCCTCGCCCATCCGAGTGGCCCTGGAGGGTTCTTCAGGGCTGGAGGGC
AAGGGGGAAGCCAGCTGGTCTGGTGCCAACCCTGGGCCCCCAGTCACTGAGAGCATCGAGACCT
CTGTAGACCGCTCACGACCACACAGCCAGCCCAGGGCCCCGCTCAAGGCCCGCGCTGCCCTGTC
CCTTGGCAGGTTTCTGAGACGGGGCTGTTTGGCATCACCAGTTTTTGCCAGGCTCTCACCGAAG
TGCCCTTCTGTGTCACACGGGAAGGTGCAGCCTCTGGGGGACATGGGTCAACAGCTGCCCAGGC
TGAAACCCAAGAAAGTAGCCAACTTTTTCCAGATCAAAATGGAAATGCCTACGGACAGTGGGCC
CTGCCTGATGGACTCGGATGACCCCGGAGCAGGAGAGTCTGGCGACCAGACCACGGAAAAGGAA
GTCATCTGCCCCTGGGAAAGCCTGGCGGAAGGGAAGGCGGGCTGAGCAGGGCCGTGCGCCGGAA
AGATGGTCCTGGCAGACACCATCAGACCTGGGGCACACTTGCTCTCAAACCCAAGTGCATTAGG
ATGATATTGGAGAACTGGAAAAAAACGAATGGGGTGGAGTCCAATGGAATGGGCGTGTGCTCTG
GTTGACTCCCAACGGCCACCTTTTCCCTTTCACTGCCTTTCCCTTGCTTGGCCAGACAGGCATG
TGGGCCAGAAGACGTCCCTTGCTGCCTTAAAATCAATAAAAGGGTCATCTGGAGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_062097	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC01959	(Get FASTA)	NCBI Sequence Viewer
	AAC52370	(Get FASTA)	NCBI Sequence Viewer
	AAC64039	(Get FASTA)	NCBI Sequence Viewer
	BAA34051	(Get FASTA)	NCBI Sequence Viewer
	EDM06455	(Get FASTA)	NCBI Sequence Viewer
	EDM06456	(Get FASTA)	NCBI Sequence Viewer
	EDM06457	(Get FASTA)	NCBI Sequence Viewer
	EDM06458	(Get FASTA)	NCBI Sequence Viewer
	EDM06459	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005076
	ENSRNOP00000005076.6
GenBank Protein	P49805	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062097 ⟸ NM_019224

- UniProtKB:

P49805 (UniProtKB/Swiss-Prot), A6HKA1 (UniProtKB/TrEMBL), A0A8I5ZNC0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMQNQRVLVTSVPHAMTGGDVLQWIIQRLW
ISNLEAQNLGNFIVKYGYIYPLQDPKNLVLKPDSSLYRFQTPYFWPTQQWPAEDTDYAIYLAKR
NIKKKGILEEYEKENYDFLNKKINYKWDFVIMQAKEQYRTGKERNKADRYALDCQEKAYWLVHR
SPPGMNNVLDYGLDRVTNPNEVKKQTVTAVRKEIMYYQQALMRSTVKSSVSLGGIVKYSEQFSS
NDAIMSGCLPSNPWITDDTQFWDLNAKLVEVPTKMRVERWAFNFSELIRDPKGRQSFQYFLKKE
FSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGARRWINIDGKTMDITVKGLRHPHRYV
LDAAQTHIYMLMKKDSYARYLKSPIYKEMLAKAIEPQETTKRSSTLPFMRRHLRSSPSPVILRQ
LEEEERAREAANTVDITQPGQHLAPSPHLAVYTGTCVPPSPSSPFSPSCRSPRKPFPSPSRFIR
RPSIAICPSPIRVALEGSSGLEGKGEASWSGANPGPPVTESIETSVDRSRPHSQPRAPLKARAA
LSLGRFLRRGCLASPVFARLSPKCPSVSHGKVQPLGDMGQQLPRLKPKKVANFFQIKMEMPTDS
GPCLMDSDDPGAGESGDQTTEKEVICPWESLAEGKAG

hide sequence

Ensembl Acc Id:

ENSRNOP00000005076 ⟸ ENSRNOT00000005076

Ensembl Acc Id:

ENSRNOP00000079708 ⟸ ENSRNOT00000105087

Ensembl Acc Id:

ENSRNOP00000082141 ⟸ ENSRNOT00000096063

Protein Domains

DEP G protein gamma Regulator of G-protein signalling DHEX RGS

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P49805-F1-model_v2	AlphaFold	P49805	1-677	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3572	AgrOrtholog
BioCyc Gene	G2FUF-22842	BioCyc
Ensembl Genes	ENSRNOG00000003800	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000005076	ENTREZGENE
	ENSRNOT00000005076.7	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.10.10	UniProtKB/Swiss-Prot
	1.10.1240.60	UniProtKB/Swiss-Prot
	1.10.167.10	UniProtKB/Swiss-Prot
	4.10.260.10	UniProtKB/Swiss-Prot
InterPro	DEP_dom	UniProtKB/Swiss-Prot
	G-protein_gamma-like_dom	UniProtKB/Swiss-Prot
	GGL_sf	UniProtKB/Swiss-Prot
	RGS	UniProtKB/Swiss-Prot
	RGS6/7/9/11	UniProtKB/Swiss-Prot
	RGS6/7/9/11_DHEX_sf	UniProtKB/Swiss-Prot
	RGS9_RGS	UniProtKB/Swiss-Prot
	RGS_DHEX	UniProtKB/Swiss-Prot
	RGS_sf	UniProtKB/Swiss-Prot
	RGS_subdomain_2	UniProtKB/Swiss-Prot
	WH-like_DNA-bd_sf	UniProtKB/Swiss-Prot
	WH_DNA-bd_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:29481	UniProtKB/Swiss-Prot
NCBI Gene	29481	ENTREZGENE
PANTHER	LP21163P	UniProtKB/Swiss-Prot
	REGULATOR OF G-PROTEIN SIGNALING 9	UniProtKB/Swiss-Prot
Pfam	DEP	UniProtKB/Swiss-Prot
	G-gamma	UniProtKB/Swiss-Prot
	RGS	UniProtKB/Swiss-Prot
	RGS_DHEX	UniProtKB/Swiss-Prot
PhenoGen	Rgs9	PhenoGen
PRINTS	RGSPROTEIN	UniProtKB/Swiss-Prot
PROSITE	DEP	UniProtKB/Swiss-Prot
	RGS	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000003800	RatGTEx
SMART	DEP	UniProtKB/Swiss-Prot
	G_gamma	UniProtKB/Swiss-Prot
	GGL	UniProtKB/Swiss-Prot
	RGS	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46785	UniProtKB/Swiss-Prot
	SSF48097	UniProtKB/Swiss-Prot
	SSF48670	UniProtKB/Swiss-Prot
TIGR	TC207366
UniProt	A0A8I5ZNC0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZTG5_RAT	UniProtKB/TrEMBL
	A6HKA0_RAT	UniProtKB/TrEMBL
	A6HKA1	ENTREZGENE, UniProtKB/TrEMBL
	A6HKA2_RAT	UniProtKB/TrEMBL
	A6HKA3_RAT	UniProtKB/TrEMBL
	A6HKA4_RAT	UniProtKB/TrEMBL
	M1S016_RAT	UniProtKB/TrEMBL
	M1SPS8_RAT	UniProtKB/TrEMBL
	P49805	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Rgs9	regulator of G-protein signaling 9			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_transcript	splicing variant Rgs9l contains a carboxy-terminal 211 amino acid proline rich-domain	69964

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)