Symbol:
Rasa1
Name:
RAS p21 protein activator 1
RGD ID:
3537
Description:
Enables several functions, including GTPase activator activity; platelet-derived growth factor receptor binding activity; and protein kinase binding activity. Involved in several processes, including activation of GTPase activity; cellular response to epidermal growth factor stimulus; and cellular response to platelet-derived growth factor stimulus. Located in nuclear membrane. Human ortholog(s) of this gene implicated in arteriovenous malformation and basal cell carcinoma. Orthologous to human RASA1 (RAS p21 protein activator 1); PARTICIPATES IN protein kinase C (PKC) signaling pathway; ephrin - ephrin receptor bidirectional signaling axis; epidermal growth factor/neuregulin signaling pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
GAP; GAPX; GTPase-activating protein; p120GAP; ras GTPase-activating protein 1; RAS p21 protein activator; RAS p21 protein activator (GTPase activating protein) 1; Rasa; rasGAP
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 17,593,136 - 17,676,707 (-) NCBI GRCr8 mRatBN7.2 2 15,857,704 - 15,940,757 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 15,857,980 - 15,940,854 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 22,959,727 - 23,040,229 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 21,059,980 - 21,140,482 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 15,733,780 - 15,814,284 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 13,617,021 - 13,696,531 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 13,616,822 - 13,696,426 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 13,470,580 - 13,551,782 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 14,203,815 - 14,287,824 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 14,124,183 - 14,208,193 (-) NCBI Celera 2 12,124,725 - 12,204,755 (-) NCBI Celera Cytogenetic Map 2 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rasa1 Rat (+)-taxifolin decreases expression ISO RASA1 (Homo sapiens) 6480464 taxifolin results in decreased expression of RASA1 mRNA CTD PMID:17541156 Rasa1 Rat 1,2-dimethylhydrazine decreases expression ISO Rasa1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of RASA1 mRNA CTD PMID:22206623 Rasa1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Rasa1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:15329391 Rasa1 Rat 17beta-estradiol increases expression ISO RASA1 (Homo sapiens) 6480464 Estradiol results in increased expression of RASA1 mRNA CTD PMID:19264808 Rasa1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:21394737 Rasa1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rasa1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RASA1 mRNA CTD PMID:21570461 Rasa1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RASA1 mRNA CTD PMID:33387578 Rasa1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RASA1 mRNA CTD PMID:34747641 Rasa1 Rat 2,6-dimethoxyphenol multiple interactions ISO RASA1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Rasa1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of RASA1 mRNA CTD PMID:21346803 Rasa1 Rat 2-hydroxypropanoic acid decreases expression ISO RASA1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of RASA1 mRNA CTD PMID:30851411 Rasa1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of RASA1 protein CTD PMID:34915118 Rasa1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RASA1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of RASA1 mRNA CTD PMID:28628672 Rasa1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of RASA1 mRNA CTD PMID:28959563 Rasa1 Rat aflatoxin B1 increases expression ISO Rasa1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of RASA1 mRNA CTD PMID:19770486 Rasa1 Rat aflatoxin B1 decreases methylation ISO RASA1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of RASA1 gene CTD PMID:27153756 Rasa1 Rat all-trans-retinoic acid increases expression ISO RASA1 (Homo sapiens) 6480464 Tretinoin results in increased expression of RASA1 mRNA CTD PMID:33167477 Rasa1 Rat aristolochic acid A decreases expression ISO RASA1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of RASA1 mRNA CTD PMID:33212167 Rasa1 Rat arsane increases methylation ISO RASA1 (Homo sapiens) 6480464 Arsenic results in increased methylation of RASA1 promoter CTD PMID:21291286 Rasa1 Rat arsenic atom increases methylation ISO RASA1 (Homo sapiens) 6480464 Arsenic results in increased methylation of RASA1 promoter CTD PMID:21291286 Rasa1 Rat arsenite(3-) multiple interactions ISO RASA1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to RASA1 mRNA] CTD PMID:32406909 Rasa1 Rat benzo[a]pyrene decreases expression ISO RASA1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of RASA1 mRNA CTD PMID:20106945 and PMID:21632981 Rasa1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RASA1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20382639 Rasa1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RASA1 mRNA CTD PMID:32145629 Rasa1 Rat bisphenol A increases expression ISO RASA1 (Homo sapiens) 6480464 bisphenol A results in increased expression of RASA1 protein CTD PMID:34186270 Rasa1 Rat bisphenol A multiple interactions ISO RASA1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of RASA1 gene CTD PMID:31601247 Rasa1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RASA1 mRNA CTD PMID:34947998 Rasa1 Rat Bisphenol B increases expression ISO RASA1 (Homo sapiens) 6480464 bisphenol B results in increased expression of RASA1 protein CTD PMID:34186270 Rasa1 Rat bisphenol F multiple interactions ISO RASA1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of RASA1 mRNA CTD PMID:28628672 Rasa1 Rat bisphenol F increases expression ISO RASA1 (Homo sapiens) 6480464 bisphenol F results in increased expression of RASA1 protein CTD PMID:34186270 Rasa1 Rat cadmium atom multiple interactions ISO RASA1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RASA1 mRNA CTD PMID:35301059 Rasa1 Rat cadmium dichloride decreases expression ISO RASA1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of RASA1 mRNA CTD PMID:38568856 Rasa1 Rat cadmium dichloride multiple interactions ISO RASA1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RASA1 mRNA CTD PMID:35301059 Rasa1 Rat cadmium sulfate decreases expression ISO Rasa1 (Mus musculus) 6480464 cadmium sulfate results in decreased expression of RASA1 mRNA CTD PMID:19274763 Rasa1 Rat caffeine decreases phosphorylation ISO RASA1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of RASA1 protein CTD PMID:35688186 Rasa1 Rat carbamazepine affects expression ISO RASA1 (Homo sapiens) 6480464 Carbamazepine affects the expression of RASA1 mRNA CTD PMID:24752500 Rasa1 Rat chlorpyrifos decreases expression ISO Rasa1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of RASA1 mRNA CTD PMID:37019170 Rasa1 Rat cisplatin multiple interactions ISO RASA1 (Homo sapiens) 6480464 Cisplatin promotes the reaction [jinfukang results in decreased expression of RASA1 mRNA] and jinfukang promotes the reaction [Cisplatin results in decreased expression of RASA1 mRNA] CTD PMID:27392435 Rasa1 Rat cobalt dichloride decreases expression ISO RASA1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of RASA1 mRNA CTD PMID:19320972 Rasa1 Rat copper atom multiple interactions ISO RASA1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of RASA1 mRNA CTD PMID:24690739 Rasa1 Rat copper(0) multiple interactions ISO RASA1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of RASA1 mRNA CTD PMID:24690739 Rasa1 Rat coumestrol decreases expression ISO RASA1 (Homo sapiens) 6480464 Coumestrol results in decreased expression of RASA1 mRNA CTD PMID:19167446 Rasa1 Rat crocidolite asbestos decreases expression ISO Rasa1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of RASA1 mRNA CTD PMID:29279043 Rasa1 Rat crocidolite asbestos decreases expression ISO RASA1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of RASA1 mRNA CTD PMID:29523930 Rasa1 Rat dexamethasone decreases expression ISO Rasa1 (Mus musculus) 6480464 Dexamethasone results in decreased expression of RASA1 mRNA CTD PMID:22733784 Rasa1 Rat dexamethasone multiple interactions ISO RASA1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of RASA1 mRNA CTD PMID:28628672 Rasa1 Rat Dibutyl phosphate affects expression ISO RASA1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of RASA1 mRNA CTD PMID:37042841 Rasa1 Rat dibutyl phthalate increases expression ISO Rasa1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of RASA1 mRNA CTD PMID:21266533 Rasa1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of RASA1 mRNA CTD PMID:21266533 Rasa1 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of RASA1 mRNA CTD PMID:18636392 Rasa1 Rat diclofenac affects expression ISO RASA1 (Homo sapiens) 6480464 Diclofenac affects the expression of RASA1 mRNA CTD PMID:24752500 Rasa1 Rat disulfiram multiple interactions ISO RASA1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of RASA1 mRNA CTD PMID:24690739 Rasa1 Rat doxorubicin affects expression ISO Rasa1 (Mus musculus) 6480464 Doxorubicin affects the expression of RASA1 mRNA CTD PMID:17367762 Rasa1 Rat epoxiconazole increases expression ISO Rasa1 (Mus musculus) 6480464 epoxiconazole results in increased expression of RASA1 mRNA CTD PMID:35436446 Rasa1 Rat fenthion increases expression ISO Rasa1 (Mus musculus) 6480464 Fenthion results in increased expression of RASA1 mRNA CTD PMID:34813904 Rasa1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of RASA1 mRNA CTD PMID:24136188 Rasa1 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of RASA1 mRNA CTD PMID:18035473 Rasa1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of RASA1 mRNA CTD PMID:24136188 Rasa1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of RASA1 mRNA CTD PMID:24793618 Rasa1 Rat folic acid affects expression ISO RASA1 (Homo sapiens) 6480464 Folic Acid affects the expression of RASA1 mRNA CTD PMID:16361273 Rasa1 Rat folic acid decreases expression ISO Rasa1 (Mus musculus) 6480464 Folic Acid results in decreased expression of RASA1 mRNA CTD PMID:25629700 Rasa1 Rat fulvestrant multiple interactions ISO RASA1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of RASA1 gene CTD PMID:31601247 Rasa1 Rat furfural multiple interactions ISO RASA1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Rasa1 Rat GTP multiple interactions ISO RASA1 (Homo sapiens) 6480464 KRAS protein mutant form inhibits the reaction [RASA1 protein promotes the reaction [KRAS protein results in increased hydrolysis of Guanosine Triphosphate]] and RASA1 protein promotes the reaction [KRAS protein results in increased hydrolysis of Guanosine Triphosphate] CTD PMID:28154176 Rasa1 Rat indometacin multiple interactions ISO RASA1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of RASA1 mRNA CTD PMID:28628672 Rasa1 Rat irinotecan decreases expression ISO RASA1 (Homo sapiens) 6480464 Irinotecan analog results in decreased expression of RASA1 mRNA CTD PMID:18927307 Rasa1 Rat isoprenaline affects localization EXP 6480464 Isoproterenol affects the localization of RASA1 protein CTD PMID:1382416 Rasa1 Rat isoprenaline multiple interactions EXP 6480464 Isoproterenol results in increased expression of and results in increased phosphorylation of RASA1 protein CTD PMID:1382416 Rasa1 Rat ivermectin decreases expression ISO RASA1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of RASA1 protein CTD PMID:32959892 Rasa1 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of RASA1 mRNA CTD PMID:20080153 Rasa1 Rat lipopolysaccharide decreases expression ISO RASA1 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of RASA1 mRNA CTD PMID:35811015 Rasa1 Rat lipopolysaccharide multiple interactions ISO RASA1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Rasa1 Rat methidathion affects expression ISO Rasa1 (Mus musculus) 6480464 methidathion affects the expression of RASA1 mRNA CTD PMID:34813904 Rasa1 Rat miconazole decreases expression ISO Rasa1 (Mus musculus) 6480464 Miconazole results in decreased expression of RASA1 mRNA CTD PMID:27462272 Rasa1 Rat mitoxantrone affects response to substance ISO RASA1 (Homo sapiens) 6480464 RASA1 mRNA affects the susceptibility to Mitoxantrone CTD PMID:16044152 Rasa1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RASA1 mRNA CTD PMID:25729387 Rasa1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of RASA1 mRNA CTD PMID:18636392 Rasa1 Rat paracetamol decreases expression ISO RASA1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of RASA1 mRNA CTD PMID:22230336 Rasa1 Rat phenethyl isothiocyanate decreases expression EXP 6480464 phenethyl isothiocyanate results in decreased expression of RASA1 mRNA CTD PMID:17616710 Rasa1 Rat phenobarbital decreases expression ISO Rasa1 (Mus musculus) 6480464 Phenobarbital results in decreased expression of RASA1 mRNA CTD PMID:23091169 Rasa1 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 more ... CTD PMID:12606953 Rasa1 Rat pirinixic acid decreases expression ISO Rasa1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of RASA1 mRNA CTD PMID:18445702 Rasa1 Rat potassium chromate decreases expression ISO RASA1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of RASA1 mRNA CTD PMID:22714537 Rasa1 Rat quercetin decreases expression ISO RASA1 (Homo sapiens) 6480464 Quercetin results in decreased expression of RASA1 mRNA CTD PMID:21632981 Rasa1 Rat rac-lactic acid decreases expression ISO RASA1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of RASA1 mRNA CTD PMID:30851411 Rasa1 Rat raloxifene increases expression EXP 6480464 Raloxifene Hydrochloride results in increased expression of RASA1 mRNA CTD PMID:15576828 Rasa1 Rat rofecoxib affects expression ISO RASA1 (Homo sapiens) 6480464 rofecoxib affects the expression of RASA1 mRNA CTD PMID:17070997 Rasa1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RASA1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Rasa1 Rat sodium arsenite increases expression ISO RASA1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of RASA1 mRNA CTD PMID:12016162 Rasa1 Rat sodium chloride multiple interactions ISO RASA1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of RASA1 protein more ... CTD PMID:38598786 Rasa1 Rat sodium fluoride decreases expression ISO Rasa1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of RASA1 mRNA CTD PMID:27862939 Rasa1 Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of RASA1 mRNA CTD PMID:24136188 Rasa1 Rat sunitinib increases expression ISO RASA1 (Homo sapiens) 6480464 Sunitinib results in increased expression of RASA1 mRNA CTD PMID:31533062 Rasa1 Rat tamoxifen affects expression ISO RASA1 (Homo sapiens) 6480464 Tamoxifen affects the expression of RASA1 mRNA CTD PMID:14699072 Rasa1 Rat temozolomide decreases expression ISO RASA1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of RASA1 mRNA CTD PMID:31758290 Rasa1 Rat testosterone decreases expression ISO RASA1 (Homo sapiens) 6480464 Testosterone results in decreased expression of RASA1 mRNA CTD PMID:33359661 Rasa1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of RASA1 mRNA CTD PMID:34492290 Rasa1 Rat titanium dioxide increases methylation ISO Rasa1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of RASA1 promoter CTD PMID:35295148 Rasa1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of RASA1 mRNA CTD PMID:25729387 Rasa1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RASA1 mRNA CTD PMID:25729387 Rasa1 Rat trichostatin A affects expression ISO Rasa1 (Mus musculus) 6480464 trichostatin A affects the expression of RASA1 mRNA CTD PMID:17367762 Rasa1 Rat triphenyl phosphate affects expression ISO RASA1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RASA1 mRNA CTD PMID:37042841 Rasa1 Rat valproic acid affects expression ISO RASA1 (Homo sapiens) 6480464 Valproic Acid affects the expression of RASA1 mRNA CTD PMID:25979313 Rasa1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of RASA1 mRNA CTD PMID:19015723
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-taxifolin (ISO) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cadmium sulfate (ISO) caffeine (ISO) carbamazepine (ISO) chlorpyrifos (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) coumestrol (ISO) crocidolite asbestos (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dichlorine (EXP) diclofenac (ISO) disulfiram (ISO) doxorubicin (ISO) epoxiconazole (ISO) fenthion (ISO) finasteride (EXP) flavonoids (EXP) flutamide (EXP) folic acid (ISO) fulvestrant (ISO) furfural (ISO) GTP (ISO) indometacin (ISO) irinotecan (ISO) isoprenaline (EXP) ivermectin (ISO) ketamine (EXP) lipopolysaccharide (ISO) methidathion (ISO) miconazole (ISO) mitoxantrone (ISO) oxaliplatin (EXP) ozone (EXP) paracetamol (ISO) phenethyl isothiocyanate (EXP) phenobarbital (ISO) PhIP (EXP) pirinixic acid (ISO) potassium chromate (ISO) quercetin (ISO) rac-lactic acid (ISO) raloxifene (EXP) rofecoxib (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium fluoride (ISO) sulindac (EXP) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) testosterone (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
actin cytoskeleton organization (NAS) activation of GTPase activity (IDA) blood vessel morphogenesis (IEA,ISO) cell adhesion (NAS) cellular response to epidermal growth factor stimulus (IDA) cellular response to fibroblast growth factor stimulus (IEP) cellular response to platelet-derived growth factor stimulus (IDA) male genitalia development (IEP) mitotic cytokinesis (ISS) negative regulation of apoptotic process (IEA,ISO,ISS) negative regulation of cell adhesion (IEA,ISO,ISS) negative regulation of cell-matrix adhesion (IEA,ISO,ISS) negative regulation of neuron apoptotic process (ISS) positive regulation of D-glucose import (IMP) positive regulation of fibroblast proliferation (IMP) positive regulation of GTPase activity (IMP) positive regulation of peptidyl-tyrosine phosphorylation (IMP) positive regulation of protein phosphorylation (IMP) regulation of actin filament polymerization (IEA,ISO,ISS) response to insulin (IEP) response to xenobiotic stimulus (IDA) signal transduction (IEA,ISO,ISS) vasculogenesis (ISS)
1.
RASA1: variable phenotype with capillary and arteriovenous malformations.
Boon LM, etal., Curr Opin Genet Dev. 2005 Jun;15(3):265-9.
2.
GTPase-activating protein interactions with the viral and cellular Src kinases.
Brott BK, etal., Proc Natl Acad Sci U S A. 1991 Feb 1;88(3):755-9.
3.
Two regions with differential growth-modulating activity in the N-terminal domain of ras GTPase-activating protein (p120GAP) src homology and Gly-Ala-Pro-rich regions.
Chang JS, etal., Eur J Biochem. 1995 Sep 15;232(3):691-9.
4.
Dysregulation of HSG triggers vascular proliferative disorders.
Chen KH, etal., Nat Cell Biol 2004 Sep;6(9):872-83. Epub 2004 Aug 22.
5.
Identification of a novel protein complex containing annexin VI, Fyn, Pyk2, and the p120(GAP) C2 domain.
Chow A, etal., FEBS Lett. 2000 Mar 3;469(1):88-92.
6.
Sequence of the cDNA encoding Ras GTPase-activating protein from rat.
Davis MM, etal., Gene 1993 Dec 8;134(2):305-6.
7.
Capillary malformation-arteriovenous malformation, a new clinical and genetic disorder caused by RASA1 mutations.
Eerola I, etal., Am J Hum Genet 2003 Dec;73(6):1240-9.
8.
Nonsense mutations in the C-terminal SH2 region of the GTPase activating protein (GAP) gene in human tumours.
Friedman E, etal., Nat Genet 1993 Nov;5(3):242-7.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
11.
PDGF-induced glycosaminoglycan synthesis is mediated via phosphatidylinositol 3-kinase.
Liu J, etal., Am J Physiol. 1998 May;274(5 Pt 1):L702-13.
12.
Oncogenic Mutations Rewire Signaling Pathways by Switching Protein Recruitment to Phosphotyrosine Sites.
Lundby A, etal., Cell. 2019 Oct 3;179(2):543-560.e26. doi: 10.1016/j.cell.2019.09.008.
13.
Purification of a novel ras GTPase-activating protein from rat brain.
Maekawa M, etal., J Biol Chem. 1993 Oct 25;268(30):22948-52.
14.
Insulin signal transduction in rat small intestine: role of MAP kinases in expression of mucosal hydrolases.
Marandi S, etal., Am J Physiol Gastrointest Liver Physiol. 2001 Feb;280(2):G229-40.
15.
The N-terminal region of GAP regulates cytoskeletal structure and cell adhesion.
McGlade J, etal., EMBO J. 1993 Aug;12(8):3073-81.
16.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
17.
Protein-tyrosine kinases regulate the phosphorylation, protein interactions, subcellular distribution, and activity of p21ras GTPase-activating protein.
Moran MF, etal., Mol Cell Biol. 1991 Apr;11(4):1804-12.
18.
Alterations in the subcellular distribution of p21ras-GTPase activating protein in proliferating rat acinar cells.
Nakagawa Y, etal., Biochem Biophys Res Commun. 1992 Sep 16;187(2):1172-9.
19.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
20.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
21.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
22.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
23.
Sex- and estrogen-dependent regulation of a miRNA network in the healthy and hypertrophied heart.
Queiros AM, etal., Int J Cardiol. 2013 Nov 20;169(5):331-8. doi: 10.1016/j.ijcard.2013.09.002. Epub 2013 Oct 5.
24.
Sodium butyrate inhibits platelet-derived growth factor-induced proliferation of vascular smooth muscle cells.
Ranganna K, etal., Arterioscler Thromb Vasc Biol. 1995 Dec;15(12):2273-83.
25.
GOA pipeline
RGD automated data pipeline
26.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
27.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
28.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
29.
miR-335 is involved in the rat epididymal development by targeting the mRNA of RASA1.
Wang J and Ruan K, Biochem Biophys Res Commun. 2010 Nov 12;402(2):222-7. doi: 10.1016/j.bbrc.2010.10.002. Epub 2010 Oct 8.
30.
Neuroprotective gene expression profiles in ischemic cortical cultures preconditioned with IGF-1 or bFGF.
Yoshida E, etal., Brain Res Mol Brain Res. 2004 Nov 24;131(1-2):33-50.
31.
Ras GTPase-activating protein binds to Akt and is required for its activation.
Yue Y, etal., J Biol Chem. 2004 Mar 26;279(13):12883-9. Epub 2004 Jan 5.
Rasa1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 17,593,136 - 17,676,707 (-) NCBI GRCr8 mRatBN7.2 2 15,857,704 - 15,940,757 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 15,857,980 - 15,940,854 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 22,959,727 - 23,040,229 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 21,059,980 - 21,140,482 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 15,733,780 - 15,814,284 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 13,617,021 - 13,696,531 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 13,616,822 - 13,696,426 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 13,470,580 - 13,551,782 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 14,203,815 - 14,287,824 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 14,124,183 - 14,208,193 (-) NCBI Celera 2 12,124,725 - 12,204,755 (-) NCBI Celera Cytogenetic Map 2 q11 NCBI
RASA1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 87,267,883 - 87,391,916 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 87,267,883 - 87,391,931 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 86,563,700 - 86,687,733 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 86,599,907 - 86,723,489 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 86,600,521 - 86,723,488 NCBI Celera 5 82,456,373 - 82,579,983 (+) NCBI Celera Cytogenetic Map 5 q14.3 NCBI HuRef 5 81,768,403 - 81,891,908 (+) NCBI HuRef CHM1_1 5 85,997,132 - 86,120,771 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 87,749,006 - 87,873,021 (+) NCBI T2T-CHM13v2.0
Rasa1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 85,362,893 - 85,437,487 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 85,362,899 - 85,437,249 (-) Ensembl GRCm39 Ensembl GRCm38 13 85,214,699 - 85,289,486 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 85,214,780 - 85,289,130 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 85,354,304 - 85,429,091 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 85,689,136 - 85,729,574 (-) NCBI MGSCv36 mm8 Celera 13 87,446,946 - 87,523,497 (-) NCBI Celera Cytogenetic Map 13 C3 NCBI cM Map 13 45.05 NCBI
Rasa1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955418 23,807,740 - 23,897,707 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955418 23,807,740 - 23,897,699 (-) NCBI ChiLan1.0 ChiLan1.0
RASA1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 28,003,513 - 28,131,187 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 26,157,126 - 26,284,812 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 27,980,907 - 28,104,368 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 28,115,159 - 28,239,854 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 28,115,159 - 28,240,321 (-) Ensembl panpan1.1 panPan2
RASA1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 21,068,182 - 21,177,288 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 21,054,930 - 21,176,757 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 22,433,878 - 22,542,367 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 20,976,854 - 21,085,576 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 20,963,599 - 21,086,379 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 20,947,976 - 21,056,165 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 20,910,527 - 21,018,703 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 21,202,248 - 21,310,549 (-) NCBI UU_Cfam_GSD_1.0
Rasa1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 176,687,034 - 176,786,016 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 5,839,743 - 5,932,021 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 5,839,560 - 5,933,049 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RASA1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 94,878,911 - 94,993,450 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 94,879,615 - 94,992,725 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 97,399,815 - 97,512,972 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RASA1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 81,249,851 - 81,371,486 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 81,249,805 - 81,370,453 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 30,268,183 - 30,393,793 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rasa1
.
Confirmed Target Of
Mir212 rno-miR-212-3p Mirtarbase external_info Immunoblot//Luciferase reporter assay//qRT-PCR Functional MTI 22431733 Mir132 rno-miR-132-3p Mirtarbase external_info Immunoblot//Luciferase reporter assay//qRT-PCR Functional MTI 22431733
Predicted Target Of
Count of predictions: 22 Count of miRNA genes: 20 Interacting mature miRNAs: 22 Transcripts: ENSRNOT00000046251 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 738010 Lnnr3 Liver neoplastic nodule remodeling QTL 3 2.94 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 2 1 41244106 Rat 10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 1600379 Mcs18 Mammary carcinoma susceptibility QTL 18 2.6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 7887772 42804738 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 61368 Mcs1 Mammary carcinoma susceptibility QTL 1 4.4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 7887772 23319447 Rat 631682 Bp115 Blood pressure QTL 115 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 1 37410502 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000046251 ⟹ ENSRNOP00000047300
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 15,857,980 - 15,940,854 (-) Ensembl Rnor_6.0 Ensembl 2 13,616,822 - 13,696,426 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095572 ⟹ ENSRNOP00000088606
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 15,857,980 - 15,940,854 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101798 ⟹ ENSRNOP00000092393
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 15,857,980 - 15,940,854 (-) Ensembl
RefSeq Acc Id:
NM_013135 ⟹ NP_037267
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 17,593,136 - 17,676,161 (-) NCBI mRatBN7.2 2 15,857,706 - 15,940,738 (-) NCBI Rnor_6.0 2 13,617,021 - 13,696,531 (-) NCBI Rnor_5.0 2 13,470,580 - 13,551,782 (-) NCBI RGSC_v3.4 2 14,203,815 - 14,287,824 (-) RGD Celera 2 12,124,725 - 12,204,755 (-) RGD
Sequence:
ATGATGGCGGCCGAGGCGGGCAGTGAGGAAGGCGGCCCGGCGACCGCGGGGACCGGCGGCGCCGCGGCCACGGGCTCCAGCGCCTACCCAGCAGCGTGCCGGGTAAAGTTACCCGCGGCCCCTCCGAT
hide sequence
RefSeq Acc Id:
XM_039101802 ⟹ XP_038957730
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 17,593,136 - 17,676,707 (-) NCBI mRatBN7.2 2 15,857,704 - 15,940,757 (-) NCBI
RefSeq Acc Id:
NP_037267 ⟸ NM_013135
- UniProtKB:
P50904 (UniProtKB/Swiss-Prot), G3V9H0 (UniProtKB/TrEMBL), A6I4M1 (UniProtKB/TrEMBL), A6I4L9 (UniProtKB/TrEMBL)
- Sequence:
MMAAEAGSEEGGPATAGTGGAAATGSSAYPAACRVKLPAAPPMAVAPCPGLADTDLAAALGGGAASGSGFLGTGPVSGVLGGAALTGGAAAGVAGAAAAGPAGDIALTKGTLSLPAETLGPGGGFPPL
hide sequence
Ensembl Acc Id:
ENSRNOP00000047300 ⟸ ENSRNOT00000046251
RefSeq Acc Id:
XP_038957730 ⟸ XM_039101802
- Peptide Label:
isoform X1
- UniProtKB:
A6I4L9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000088606 ⟸ ENSRNOT00000095572
Ensembl Acc Id:
ENSRNOP00000092393 ⟸ ENSRNOT00000101798
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-03
Rasa1
RAS p21 protein activator 1
Rasa1
RAS p21 protein activator (GTPase activating protein) 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-24
Rasa1
RAS p21 protein activator (GTPase activating protein) 1
Rasa1
RAS p21 protein activator 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2000-11-11
Rasa1
RAS p21 protein activator 1
Symbol updated
61033 APPROVED
2000-11-11
Rasa
RAS p21 protein activator
Symbol withdrawn
61033 WITHDRAWN
